StarFunc result for job id Q5SYE7

User Input

>input (1610 residues)
MKKEGSSGSFRLQPNTGSLSRAVSWINFSSLSRQTKRLFRSDGELSVCGQQVEVDDENWI
YRAQPRKAVSNLDEESRWTVHYTAPWHQQENVFLPTTRPPCVEDLHRQAKLNLKSVLREC
DKLRHDGYRSSQYYSQGPTFAANASPFCDDYQDEDEETDQKCSLSSSEEERFISIRRPKT
PASSDFSDLNTQTNWTKSLPLPTPEEKMRQQAQTVQADVVPINITASGTGQDDADGHSVY
TPDHYSTLGRFNSCRSAGQRSETRDSSCQTEDVKVVPPSMRRIRAQKGQGIAAQMGHFSG
SSGNMSVLSDSAGIVFPSRLDSDAGFHSLPRSGARANIQSLEPRLGALGPAGDMNGTFLY
QRGHPQADENLGHLGGASGTGTLLRPKSQELRHFESENIMSPACVVSPHATYSTSIIPNA
TLSSSSEVIAIPTAQSAGQRESKSSGSSHARIKSRDHLISRHAVKGDPQSPGRHWNEGHA
TILSQDLDPHSPGEPALLSLCDSAVPLNAPANRENGSQAMPYNCRNNLAFPAHPQDVDGK
SESSYSGGGGHSSSEPWEYKSSGNGRASPLKPHLATPGYSTPTSNMSSCSLDQTSNKEDA
GSLYSEDHDGYCASVHTDSGHGSGNLCNSSDGFGNPRHSVINVFVGRAQKNQGDRSNYQD
KSLSRNISLKKAKKPPLPPSRTDSLRRIPKKSSQCNGQVLNESLIATLQHSLQLSLPGKS
GSSPSQSPCSDLEEPWLPRSRSQSTVSAGSSMTSATTPNVYSLCGATPSQSDTSSVKSEY
TDPWGYYIDYTGMQEDPGNPAGGCSTSSGVPTGNGPVRHVQEGSRATMPQVPGGSVKPKI
MSPEKSHRVISPSSGYSSQSNTPTALTPVPVFLKSVSPANGKGKPKPKVPERKSSLISSV
SISSSSTSLSSSTSTEGSGTMKKLDPAVGSPPAPPPPPVPSPPFPCPADRSPFLPPPPPV
TDCSQGSPLPHSPVFPPPPPEALIPFCSPPDWCLSPPRPALSPILPDSPVSLPLPPPLLP
SSEPPPAPPLDPKFMKDTRPPFTNSGQPESSRGSLRPPSTKEETSRPPMPLITTEALQMV
QLRPVRKNSGAEAAQLSERTAQEQRTPVAPQYHLKPSAFLKSRNSTNEMESESQPASVTS
SLPTPAKSSSQGDHGSAAERGGPVSRSPGAPSAGEAEARPSPSTTPLPDSSPSRKPPPIS
KKPKLFLVVPPPQKDFAVEPAENVSEALRAVPSPTTGEEGSVHSREAKESSAAQAGSHAT
HPGTSVLEGGAAGSMSPSRVEANVPMVQPDVSPAPKQEEPAENSADTGGDGESCLSQQDG
AAGVPETNAAGSSSEACDFLKEDGNDEVMTPSRPRTTEDLFAAIHRSKRKVLGRRDSDDD
HSRNHSPSPPVTPTGAAPSLASPKQVGSIQRSIRKSSTSSDNFKALLLKKGSRSDTSARM
SAAEMLKNTDPRFQRSRSEPSPDAPESPSSCSPSKNRRAQEEWAKNEGLMPRSLSFSGPR
YGRSRTPPSAASSRYSMRNRIQSSPMTVISEGEGEAVEPVDSIARGALGAAEGCSLDGLA
REEMDEGGLLCGEGPAASLQPQAPGPVDGTASAEGREPSPQCGGSLSEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EXR7	0.053	0.053	8.895E-59	1606	0.395	0.396	E7EXR7.pdb.gz	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
2	AFDB:B1AV60	0.044	0.044	5.870E-27	1647	0.265	0.259	B1AV60.pdb.gz	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
3	AFDB:Q6T4R5	0.054	0.053	8.786E-26	1651	0.265	0.259	Q6T4R5.pdb.gz	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
4	AFDB:Q86B80	0.033	0.031	3.342E-5	1744	0.158	0.146	Q86B80.pdb.gz	Q86B80_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG7029 PE=4 SV=1
5	AFDB:Q9UMD9	0.030	0.032	1.087E-4	1497	0.151	0.162	Q9UMD9.pdb.gz	COHA1_HUMAN Collagen alpha-1(XVII) chain OS=Homo sapiens OX=9606 GN=COL17A1 PE=1 SV=3
6	AFDB:Q9NZ56	0.030	0.029	1.001E-3	1722	0.145	0.136	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
7	AFDB:Q4WCP6	0.043	0.061	1.744E-3	881	0.093	0.169	Q4WCP6.pdb.gz	Q4WCP6_ASPFU GATA transcriptional activator AreA OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_6G01970 PE=4 SV=1
8	AFDB:F8VPZ9	0.029	0.030	4.010E-3	1578	0.155	0.158	F8VPZ9.pdb.gz	BICRA_MOUSE BRD4-interacting chromatin-remodeling complex-associated protein OS=Mus musculus OX=10090 GN=Bicra PE=1 SV=1
9	AFDB:Q07092	0.034	0.034	4.298E-3	1604	0.156	0.156	Q07092.pdb.gz	COGA1_HUMAN Collagen alpha-1(XVI) chain OS=Homo sapiens OX=9606 GN=COL16A1 PE=1 SV=2
10	AFDB:Q07563	0.030	0.032	4.298E-3	1470	0.132	0.145	Q07563.pdb.gz	COHA1_MOUSE Collagen alpha-1(XVII) chain OS=Mus musculus OX=10090 GN=Col17a1 PE=1 SV=3
11	PDB:7r5jV0	0.024	0.104	5.300	273	0.012	0.073	7r5jV0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
12	PDB:3j4qB	0.019	0.060	6.088	382	0.014	0.058	3j4qB.pdb.gz
13	PDB:7ung2	0.022	0.069	6.526	446	0.013	0.047	7ung2.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E7EXR7	3.44e-92	333	1606	0.124	0.124	E7EXR7_DANRE NHS-like 1b OS=Danio rerio OX=7955 GN=nhsl1b PE=1 SV=2
2	B9EJX2	1.58e-44	180	1626	0.072	0.071	B9EJX2_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
3	A0A087WU78	1.73e-43	176	1447	0.073	0.082	A0A087WU78_HUMAN NHS actin remodeling regulator OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=1
4	B1AV60	8.00e-43	174	1647	0.075	0.073	B1AV60_MOUSE NHS actin remodeling regulator OS=Mus musculus OX=10090 GN=Nhs PE=1 SV=1
5	B2RXX7	8.14e-43	174	1647	0.075	0.073	B2RXX7_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
6	Q6T4R5	6.09e-42	171	1651	0.075	0.073	NHS_HUMAN Actin remodeling regulator NHS OS=Homo sapiens OX=9606 GN=NHS PE=1 SV=2
7	B7ZWM3	7.02e-42	171	1647	0.075	0.073	B7ZWM3_MOUSE Nhs protein OS=Mus musculus OX=10090 GN=Nhs PE=2 SV=1
8	Q5HYW2	3.24e-11	70.9	1225	0.033	0.043	NHSL2_HUMAN NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=2
9	Q9SKI0	0.083	39.3	291	0.027	0.151	Q9SKI0_ARATH At2g10940/F15K19.1 OS=Arabidopsis thaliana OX=3702 GN=At2g10940 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03964 Chorion_2	1.1e+02	14.9	Chorion family 2
2	PF15273 NHS	4.4e-260	876.7	NHS-like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394546

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000479060	0.766	Coiled-coil domain containing 28A
2	9606.ENSP00000424079	0.723	NHS-like protein 2
3	9606.ENSP00000295851	0.694	Abl interactor 2
4	9606.ENSP00000308149	0.639	Archaemetzincin-1
5	9606.ENSP00000442307	0.631	Epithelial cell-transforming sequence 2 oncogene-like
6	9606.ENSP00000233154	0.600	Cytoplasmic protein NCK2
7	9606.ENSP00000349824	0.560	RalBP1-associated Eps domain-containing protein 2
8	9606.ENSP00000371318	0.530	Transmembrane protein 74B
9	9606.ENSP00000253329	0.528	Peptidyl-prolyl cis-trans isomerase-like 4
10	9606.ENSP00000356563	0.523	Peroxisomal biogenesis factor 3
11	9606.ENSP00000363226	0.518	Chromosome 10 open reading frame 53
12	9606.ENSP00000450857	0.506	Stonin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046982	0.999	protein heterodimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032501	0.815	multicellular organismal process
GO:0065007	0.743	biological regulation
GO:0050789	0.713	regulation of biological process
GO:0048856	0.678	anatomical structure development
GO:0030154	0.659	cell differentiation
GO:0050794	0.655	regulation of cellular process
GO:0016477	0.648	cell migration
GO:0048731	0.645	system development
GO:0001764	0.553	neuron migration
GO:0050896	0.331	response to stimulus
GO:0071840	0.320	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.995	membrane
GO:0005622	0.823	intracellular anatomical structure
GO:0005829	0.796	cytosol
GO:0043227	0.778	membrane-bounded organelle
GO:0043229	0.740	intracellular organelle
GO:0043231	0.643	intracellular membrane-bounded organelle
GO:0071944	0.535	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]