StarFunc result for job id Q5SZD4

User Input

>input (288 residues)
MLVLNCSTKLLILEKMLKSCFPESLKVYGAVMNINRGNPFQKEVVLDSWPDFKAVITRRQ
REAETDNLDHYTNAYAVFYKDVRAYRQLLEECDVFNWDQVFQIQGLQSELYDVSKAVANS
KQLNIKLTSFKAVHFSPVSSLPDTSFLKGPSPRLTYLSVANADLLNRTWSRGGNEQCLRY
IANLISCFPSVCVRDEKGNPVSWSITDQFATMCHGYTLPEHRRKGYSRLVALTLARKLQS
RGFPSQGNVLDDNTASISLLKSLHAEFLPCRFHRLILTPATFSGLPHL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q5L8	0.985	0.978	2.903E-51	290	0.861	0.855	E9Q5L8.pdb.gz	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
2	AFDB:Q2KIR7	0.907	0.886	2.760E-31	295	0.351	0.342	Q2KIR7.pdb.gz	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
3	AFDB:Q91XE0	0.892	0.869	5.755E-31	296	0.351	0.341	Q91XE0.pdb.gz	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
4	AFDB:Q969I3	0.933	0.891	1.200E-30	302	0.340	0.325	Q969I3.pdb.gz	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
5	PDB:7pk1A	0.893	0.893	6.614E-30	288	0.340	0.340	7pk1A.pdb.gz
6	AFDB:Q5FW57	0.873	0.851	1.442E-29	296	0.326	0.318	Q5FW57.pdb.gz	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
7	AFDB:Q8WU03	0.887	0.870	1.913E-29	294	0.340	0.333	Q8WU03.pdb.gz	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
8	AFDB:Q9DCY0	0.897	0.877	3.181E-29	295	0.340	0.332	Q9DCY0.pdb.gz	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
9	AFDB:Q9Z2Y0	0.881	0.861	3.988E-29	295	0.326	0.319	Q9Z2Y0.pdb.gz	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
10	AFDB:Q6IB77	0.882	0.859	2.883E-28	296	0.344	0.334	Q6IB77.pdb.gz	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
11	AFDB:Q22371	0.782	0.760	1.644E-16	297	0.153	0.148	Q22371.pdb.gz	Q22371_CAEEL Glycine N-acyltransferase-like protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B10.4 PE=1 SV=3
12	PDB:2c27A	0.414	0.400	2.814E-7	301	0.128	0.123	2c27A.pdb.gz	The Substrate-Induced Conformational Change of Mycobacterium Tuberculosis Mycothiol Synthase.
13	PDB:2wpwA	0.526	0.480	3.334E-7	328	0.139	0.122	2wpwA.pdb.gz	Crystallographic and mass spectrometric analyses of a tandem GNAT protein from the clavulanic acid biosynthesis pathway.
14	PDB:4ii9A	0.411	0.366	1.767E-4	337	0.128	0.110	4ii9A.pdb.gz	The Structure of FemXWv in Complex with a Peptidyl-RNA Conjugate: Mechanism of Aminoacyl Transfer from Ala-tRNA(Ala) to Peptidoglycan Precursors
15	PDB:2p6eC	0.339	0.247	4.618E-4	446	0.132	0.085	2p6eC.pdb.gz	Crystal structures of Saccharomyces cerevisiae N-myristoyltransferase with bound myristoyl-CoA and inhibitors reveal the functional roles of the N-terminal region.
16	PDB:6tdfA	0.325	0.529	1.601E-3	165	0.066	0.115	6tdfA.pdb.gz	Targeting a critical step in fungal hexosamine biosynthesis.
17	PDB:2beiB	0.293	0.488	3.737E-3	159	0.083	0.151	2beiB.pdb.gz	Crystal structure of Homo sapiens thialysine Nepsilon-acetyltransferase (HsSSAT2) in complex with acetyl coenzyme A.
18	PDB:3t90A	0.326	0.593	4.428E-3	147	0.059	0.116	3t90A.pdb.gz
19	PDB:3fb3B	0.308	0.541	4.958E-3	149	0.073	0.141	3fb3B.pdb.gz
20	PDB:6yugA	0.335	0.617	5.246E-3	143	0.056	0.112	6yugA.pdb.gz	Plasmodium falciparum Apicomplexan-Specific Glucosamine-6-Phosphate N -Acetyltransferase Is Key for Amino Sugar Metabolism and Asexual Blood Stage Development.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q5L8	0.0	521	290	0.861	0.855	GLYL3_MOUSE Glycine-N-acyltransferase-like protein 3 OS=Mus musculus OX=10090 GN=Glyatl3 PE=1 SV=1
2	Q8WU03	9.47e-54	178	294	0.358	0.350	GLYL2_HUMAN Glycine N-acyltransferase-like protein 2 OS=Homo sapiens OX=9606 GN=GLYATL2 PE=1 SV=1
3	Q2KIR7	1.03e-53	178	295	0.365	0.356	GLYAT_BOVIN Glycine N-acyltransferase OS=Bos taurus OX=9913 GN=GLYAT PE=1 SV=2
4	Q969I3	1.13e-52	176	302	0.358	0.341	GLYL1_HUMAN Glycine N-acyltransferase-like protein 1 OS=Homo sapiens OX=9606 GN=GLYATL1 PE=1 SV=1
5	Q9DCY0	1.26e-52	175	295	0.365	0.356	KEG1_MOUSE Glycine N-acyltransferase-like protein Keg1 OS=Mus musculus OX=10090 GN=Keg1 PE=1 SV=1
6	Q6IB77	5.48e-51	171	296	0.347	0.338	GLYAT_HUMAN Glycine N-acyltransferase OS=Homo sapiens OX=9606 GN=GLYAT PE=1 SV=3
7	Q9Z2Y0	5.62e-51	171	295	0.351	0.342	KEG1_RAT Glycine N-acyltransferase-like protein Keg1 OS=Rattus norvegicus OX=10116 GN=Keg1 PE=1 SV=2
8	Q91XE0	1.04e-50	171	296	0.354	0.345	GLYAT_MOUSE Glycine N-acyltransferase OS=Mus musculus OX=10090 GN=Glyat PE=1 SV=1
9	Q5FW57	1.52e-50	170	296	0.333	0.324	GLYAL_MOUSE Glycine N-acyltransferase-like protein OS=Mus musculus OX=10090 GN=Gm4952 PE=1 SV=3
10	Q22371	5.70e-07	52.4	297	0.108	0.104	Q22371_CAEEL Glycine N-acyltransferase-like protein OS=Caenorhabditis elegans OX=6239 GN=CELE_T10B10.4 PE=1 SV=3
11	Q8GXV5	0.85	33.5	298	0.069	0.067	UGHY_ARATH (S)-ureidoglycine aminohydrolase OS=Arabidopsis thaliana OX=3702 GN=UGLYAH PE=1 SV=1
12	Q382Y3	4.2	30.0	121	0.104	0.248	Q382Y3_TRYB2 Microtubule-associated protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3805 PE=4 SV=1
13	Q8WSH6	4.2	30.0	121	0.104	0.248	Q8WSH6_9TRYP Corset-associated protein 15 OS=Trypanosoma brucei OX=5691 GN=CAP15 PE=4 SV=1
14	Q80W68	9.3	30.4	789	0.090	0.033	KIRR1_MOUSE Kin of IRRE-like protein 1 OS=Mus musculus OX=10090 GN=Kirrel1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00583 Acetyltransf_1	18	17.0	Acetyltransferase (GNAT) family
2	PF08445 FR47	2.7e-05	35.4	FR47-like protein
3	PF08444 Gly_acyl_tr_C	2.8e-09	48.4	Aralkyl acyl-CoA:amino acid N-acyltransferase, C-terminal region
4	PF06021 Gly_acyl_tr_N	2.6e-73	258.0	Aralkyl acyl-CoA:amino acid N-acyltransferase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360240

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000306100	0.620	Peptidyl-glycine alpha-amidating monooxygenase
2	9606.ENSP00000217428	0.565	Serine peptidase inhibitor, Kunitz type 3
3	9606.ENSP00000385006	0.530	THAP domain containing 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0047961	0.996	glycine N-acyltransferase activity
GO:0005515	0.897	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0019752	0.994	carboxylic acid metabolic process
GO:0006807	0.979	nitrogen compound metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0032787	0.633	monocarboxylic acid metabolic process
GO:0006520	0.366	amino acid metabolic process
GO:1901605	0.362	alpha-amino acid metabolic process
GO:0006629	0.326	lipid metabolic process
GO:0044255	0.322	cellular lipid metabolic process
GO:0050896	0.315	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005739	0.962	mitochondrion
GO:0012505	0.955	endomembrane system
GO:0016020	0.691	membrane
GO:0043233	0.488	organelle lumen
GO:0070013	0.484	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:19869	0.996	an acyl-CoA + glycine = an N-acylglycine + CoA + H(+)
EC:2.3.1.13	0.996	glycine N-acyltransferase.

[back to server]