StarFunc result for job id Q5SZJ8

User Input

>input (279 residues)
MQKIVQTDEITNTQAFRKGKRKRTETMDSENANSDMDKGQRDPYSGNAFLPGESSSEDEE
PLAELSKEELCAKIKSLKEKLTNTRKENSRLRQSLVMLQVLPQAVTQFEELVGMAEALLK
GGGTMSTSASTLWRATNNSSPDSFASTCSNSNSNSSSPVSLKPEEEHQTDEKQFQIEKWQ
IARCNKSKPQKFINDLMQVLYTNEYMATHSLTGAKSSTSRDKAVKPAMNQNEVQEIIGVT
KQLFPNTDDVSIRRMIGQKLNNCTKKPNLSKNLNSQDIK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5SZJ8	1.000	1.000	1.199E-38	279	1.000	1.000	Q5SZJ8.pdb.gz	BEND6_HUMAN BEN domain-containing protein 6 OS=Homo sapiens OX=9606 GN=BEND6 PE=1 SV=2
2	AFDB:Q6PFX2	0.780	0.775	9.573E-31	281	0.832	0.826	Q6PFX2.pdb.gz	BEND6_MOUSE BEN domain-containing protein 6 OS=Mus musculus OX=10090 GN=Bend6 PE=1 SV=1
3	AFDB:Q9VQD6	0.307	0.227	3.433E-7	381	0.172	0.126	Q9VQD6.pdb.gz	ELBA2_DROME Early boundary activity protein 2 OS=Drosophila melanogaster OX=7227 GN=Elba2 PE=1 SV=1
4	AFDB:Q8SYK5	0.299	0.224	3.984E-4	376	0.194	0.144	Q8SYK5.pdb.gz	INSV_DROME Protein insensitive OS=Drosophila melanogaster OX=7227 GN=insv PE=1 SV=2
5	AFDB:Q7L4P6	0.277	0.196	6.733E-4	421	0.161	0.107	Q7L4P6.pdb.gz	BEND5_HUMAN BEN domain-containing protein 5 OS=Homo sapiens OX=9606 GN=BEND5 PE=1 SV=1
6	AFDB:Q22812	0.100	0.078	5.837E-1	399	0.143	0.100	Q22812.pdb.gz	HM39_CAEEL Homeobox protein ceh-39 OS=Caenorhabditis elegans OX=6239 GN=ceh-39 PE=1 SV=1
7	AFDB:Q9LK27	0.114	0.051	8.283E-1	813	0.179	0.062	Q9LK27.pdb.gz	GTE8_ARATH Transcription factor GTE8 OS=Arabidopsis thaliana OX=3702 GN=GTE8 PE=2 SV=2
8	PDB:7mezB	0.101	0.061	2.312	547	0.036	0.018	7mezB.pdb.gz
9	AFDB:Q5A034	0.138	0.058	4.000	903	0.082	0.025	Q5A034.pdb.gz	Q5A034_CANAL DNA replication licensing factor MCM2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MCM2 PE=3 SV=1
10	PDB:1oohA	0.098	0.166	4.392	126	0.032	0.071	1oohA.pdb.gz	Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster
11	PDB:6pskR	0.104	0.271	4.656	72	0.032	0.125	6pskR.pdb.gz
12	AFDB:F4HWD0	0.120	0.078	4.764	517	0.151	0.081	F4HWD0.pdb.gz	F4HWD0_ARATH DUF547 domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=At1g21060 PE=1 SV=2
13	PDB:3vvlB	0.080	0.066	4.935	369	0.022	0.016	3vvlB.pdb.gz
14	AFDB:Q8IYN2	0.144	0.270	5.051	117	0.086	0.205	Q8IYN2.pdb.gz	TCAL8_HUMAN Transcription elongation factor A protein-like 8 OS=Homo sapiens OX=9606 GN=TCEAL8 PE=1 SV=1
15	PDB:7z6hD	0.092	0.083	6.232	324	0.039	0.034	7z6hD.pdb.gz	Structure of the human RAD17-RFC clamp loader and 9-1-1 checkpoint clamp bound to a dsDNA-ssDNA junction.
16	PDB:7czbA	0.122	0.161	7.003	194	0.032	0.046	7czbA.pdb.gz
17	PDB:1z3hB	0.111	0.043	7.423	914	0.047	0.014	1z3hB.pdb.gz	The structure of the nuclear export receptor cse1 in its cytosolic state reveals a closed conformation incompatible with cargo binding
18	PDB:1cqxA	0.106	0.079	7.869	403	0.036	0.025	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
19	PDB:3geiC	0.115	0.111	7.869	298	0.029	0.027	3geiC.pdb.gz
20	PDB:3cogD	0.072	0.058	8.342	392	0.025	0.018	3cogD.pdb.gz	Structural basis for the inhibition mechanism of human cystathionine gamma-lyase, an enzyme responsible for the production of H(2)S.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5SZJ8	0.0	576	279	1.000	1.000	BEND6_HUMAN BEN domain-containing protein 6 OS=Homo sapiens OX=9606 GN=BEND6 PE=1 SV=2
2	Q6PFX2	1.56e-160	449	281	0.832	0.826	BEND6_MOUSE BEN domain-containing protein 6 OS=Mus musculus OX=10090 GN=Bend6 PE=1 SV=1
3	Q804T6	1.7	32.3	443	0.082	0.052	DIX1A_DANRE Dixin-A OS=Danio rerio OX=7955 GN=dixdc1a PE=1 SV=1
4	Q8VQF5	2.1	32.3	451	0.072	0.044	CINB_CITBR Cindoxin reductase OS=Citrobacter braakii OX=57706 GN=cinB PE=3 SV=1
5	Q8SYK5	2.9	31.6	376	0.054	0.040	INSV_DROME Protein insensitive OS=Drosophila melanogaster OX=7227 GN=insv PE=1 SV=2
6	Q4QGE1	6.1	30.8	729	0.054	0.021	Q4QGE1_LEIMA Kinesin-like protein OS=Leishmania major OX=5664 GN=LMJF_13_0130 PE=3 SV=1
7	Q2RSB4	7.5	30.4	464	0.054	0.032	PNTB_RHORT NAD(P) transhydrogenase subunit beta OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIMB 8255 / S1) OX=269796 GN=pntB PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10523 BEN	2.1e-09	48.8	BEN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359782

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000345773	0.880	BEN domain containing 7
2	9606.ENSP00000477213	0.719	Amyloid-beta A4 precursor protein-binding family B member 1
3	9606.ENSP00000388731	0.621	Sperm specific antigen 2
4	9606.ENSP00000359768	0.601	E3 SUMO-protein ligase KIAA1586
5	9606.ENSP00000345206	0.583	Recombining binding protein suppressor of hairless
6	9606.ENSP00000394560	0.583	Mitogen-activated protein kinase 9
7	9606.ENSP00000261441	0.536	Lysine-specific demethylase 9
8	9606.ENSP00000277554	0.519	Nucleus accumbens-associated protein 2
9	9606.ENSP00000292431	0.505	Nucleus accumbens-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	1.000	transcription corepressor activity
GO:0005488	0.991	binding
GO:0005515	0.878	protein binding
GO:0003682	0.379	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0048519	0.988	negative regulation of biological process
GO:0048522	0.968	positive regulation of cellular process
GO:0048523	0.946	negative regulation of cellular process
GO:0019222	0.845	regulation of metabolic process
GO:0060255	0.824	regulation of macromolecule metabolic process
GO:0031323	0.823	regulation of cellular metabolic process
GO:0048583	0.810	regulation of response to stimulus
GO:0051171	0.808	regulation of nitrogen compound metabolic process
GO:0080090	0.705	regulation of primary metabolic process
GO:0019219	0.701	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.699	regulation of cellular biosynthetic process
GO:0051252	0.677	regulation of RNA metabolic process
GO:0010556	0.633	regulation of macromolecule biosynthetic process
GO:0010468	0.618	regulation of gene expression
GO:2001141	0.607	regulation of RNA biosynthetic process
GO:0009892	0.591	negative regulation of metabolic process
GO:0010605	0.536	negative regulation of macromolecule metabolic process
GO:0051172	0.508	negative regulation of nitrogen compound metabolic process
GO:0031324	0.451	negative regulation of cellular metabolic process
GO:0006355	0.436	regulation of DNA-templated transcription
GO:0009987	0.401	cellular process
GO:0009966	0.372	regulation of signal transduction
GO:0045934	0.357	negative regulation of nucleobase-containing compound metabolic process
GO:0009890	0.353	negative regulation of biosynthetic process
GO:0045892	0.308	negative regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.986	nuclear lumen
GO:0005654	0.977	nucleoplasm
GO:0005737	0.681	cytoplasm
GO:0016604	0.306	nuclear body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]