StarFunc result for job id Q5SZK8

User Input

>input (1400 residues)
MHSAGTPGLSSRRTGNSTSFQPGPPPPPRLLLLLLLLLSLVSRVPAQPAAFGRALLSPGL
AGAAGVPAEEAIVLANRGLRVPFGREVWLDPLHDLVLQVQPGDRCAVSVLDNDALAQRPG
RLSPKRFPCDFGPGEVRYSHLGARSPSRDRVRLQLRYDAPGGAVVLPLVLEVEVVFTQLE
VVTRNLPLVVEELLGTSNALDARSLEFAFQPETEECRVGILSGLGALPRYGELLHYPQVP
GGAREGGAPETLLMDCKAFQELGVRYRHTAASRSPNRDWIPMVVELRSRGAPVGSPALKR
EHFQVLVRIRGGAENTAPKPSFVAMMMMEVDQFVLTALTPDMLAAEDAESPSDLLIFNLT
SPFQPGQGYLVSTDDRSLPLSSFTQRDLRLLKIAYQPPSEDSDQERLFELELEVVDLEGA
ASDPFAFMVVVKPMNTMAPVVTRNTGLILYEGQSRPLTGPAGSGPQNLVISDEDDLEAVR
LEVVAGLRHGHLVILGASSGSSAPKSFTVAELAAGQVVYQHDDRDGSLSDNLVLRMVDGG
GRHQVQFLFPITLVPVDDQPPVLNANTGLTLAEGETVPILPLSLSATDMDSDDSLLLFVL
ESPFLTTGHLLLRQTHPPHEKQELLRGLWRKEGAFYERTVTEWQQQDITEGRLFYRHSGP
HSPGPVTDQFTFRVQDNHDPPNQSGLQRFVIRIHPVDRLPPELGSGCPLRMVVQESQLTP
LRKKWLRYTDLDTDDRELRYTVTQSPTDTDENHLPAPLGTLVLTDNPSVVVTHFTQAQIN
HHKIAYRPPGQELGVATRVAQFQFQVEDRAGNVAPGTFTLYLHPVDNQPPEILNTGFTIQ
EKGHHILSETELHVNDVDTDVAHISFTLTQAPKHGHMRVSGQILHVGGLFHLEDIKQGRV
SYAHNGDKSLTDSCSLEVSDRHHVVPITLRVNVRPVDDEVPILSHPTGTLESYLDVLENG
ATEITANVIKGTNEETDDLMLTFLLEDPPLYGEILVNGIPAEQFTQRDILEGSVVYTHTS
GEIGLLPKADSFNLSLSDMSQEWRIGGNTIQGVTIWVTILPVDSQAPEIFVGEQLIVMEG
DKSVITSVHISAEDVDSLNDDILCTIVIQPTSGYVENISPAPGSEKSRAGIAISAFNLKD
LRQGHINYVQSVHKGVEPVEDRFVFRCSDGINFSERQFFPIVIIPTNDEQPEMFMREFMV
MEGMSLVIDTPILNAADADVPLDDLTFTITQFPTHGHIMNQLINGTVLVESFTLDQIIES
SSIIYEHDDSETQEDSFVIKLTDGKHSVEKTVLIIVIPVDDETPRMTINNGLEIEIGDTK
IINNKILMATDLDSEDKSLVYIIRYGPGHGLLQRRKPTGAFENITLGMNFTQDEVDRNLI
QYVHLGQEGIRDLIKFDVTD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1R4B2	0.347	0.241	0.000	2167	0.321	0.208	F1R4B2.pdb.gz
2	AFDB:P0C091	0.516	0.352	0.000	2139	0.539	0.353	P0C091.pdb.gz	FREM3_HUMAN FRAS1-related extracellular matrix protein 3 OS=Homo sapiens OX=9606 GN=FREM3 PE=3 SV=2
3	AFDB:Q5H8B9	0.602	0.436	0.000	2123	0.494	0.326	Q5H8B9.pdb.gz	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
4	AFDB:Q5H8C1	0.332	0.237	0.000	2179	0.339	0.218	Q5H8C1.pdb.gz	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
5	AFDB:Q684R7	0.366	0.260	0.000	2191	0.331	0.212	Q684R7.pdb.gz	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
6	AFDB:Q6UVK1	0.099	0.068	1.127E-71	2322	0.191	0.115	Q6UVK1.pdb.gz	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
7	AFDB:Q8VHY0	0.118	0.080	5.367E-70	2327	0.182	0.110	Q8VHY0.pdb.gz	CSPG4_MOUSE Chondroitin sulfate proteoglycan 4 OS=Mus musculus OX=10090 GN=Cspg4 PE=1 SV=3
8	AFDB:Q9VJ82	0.156	0.097	9.433E-66	2381	0.177	0.104	Q9VJ82.pdb.gz	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3
9	AFDB:Q54KF7	0.154	0.119	1.146E-42	1927	0.130	0.094	Q54KF7.pdb.gz	SIBA_DICDI Integrin beta-like protein A OS=Dictyostelium discoideum OX=44689 GN=sibA PE=1 SV=2
10	AFDB:Q54JA3	0.185	0.142	4.253E-36	1946	0.131	0.095	Q54JA3.pdb.gz	SIBE_DICDI Integrin beta-like protein E OS=Dictyostelium discoideum OX=44689 GN=sibE PE=1 SV=1
11	PDB:7sqcO0	0.082	0.093	7.413E-20	1140	0.084	0.103	7sqcO0.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
12	PDB:4aq1A	0.076	0.127	1.649E-13	721	0.067	0.130	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
13	PDB:5a42A	0.067	0.062	1.470E-12	1597	0.090	0.079	5a42A.pdb.gz
14	PDB:7q5zA	0.072	0.075	4.705E-12	1344	0.076	0.079	7q5zA.pdb.gz
15	PDB:7q1yA	0.067	0.068	1.250E-11	1374	0.078	0.079	7q1yA.pdb.gz
16	PDB:4ziqA	0.069	0.067	1.168E-10	1450	0.081	0.078	4ziqA.pdb.gz
17	PDB:1e07A	0.096	0.162	1.618E-10	642	0.048	0.104	1e07A.pdb.gz
18	PDB:4lnvA	0.075	0.081	8.641E-10	1276	0.068	0.074	4lnvA.pdb.gz
19	PDB:7vonA	0.095	0.095	1.820E-9	1399	0.073	0.073	7vonA.pdb.gz
20	PDB:7nycA	0.076	0.071	3.658E-9	1542	0.065	0.059	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B6IDE6	0.0	1605	3113	0.566	0.254	B6IDE6_DANRE FRAS1-related extracellular matrix protein 2 precursor OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
2	D7PS89	0.0	659	2167	0.322	0.208	D7PS89_DANRE FRAS1-related extracellular matrix protein 1 precursor OS=Danio rerio OX=7955 GN=rfl PE=2 SV=1
3	D7PS91	0.0	1606	3119	0.566	0.254	D7PS91_DANRE FRAS1-related extracellular matrix 2a OS=Danio rerio OX=7955 GN=bla PE=1 SV=1
4	P0C091	0.0	1407	2139	0.540	0.353	FREM3_HUMAN FRAS1-related extracellular matrix protein 3 OS=Homo sapiens OX=9606 GN=FREM3 PE=3 SV=2
5	Q5H8B9	0.0	1252	2123	0.497	0.328	FREM3_MOUSE FRAS1-related extracellular matrix protein 3 OS=Mus musculus OX=10090 GN=Frem3 PE=2 SV=2
6	Q5H8C1	0.0	722	2179	0.343	0.220	FREM1_HUMAN FRAS1-related extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=FREM1 PE=1 SV=3
7	Q5SZK8	0.0	2854	3169	0.999	0.441	FREM2_HUMAN FRAS1-related extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=FREM2 PE=1 SV=3
8	Q684R7	0.0	699	2191	0.338	0.216	FREM1_MOUSE FRAS1-related extracellular matrix protein 1 OS=Mus musculus OX=10090 GN=Frem1 PE=1 SV=1
9	Q6NVD0	0.0	2471	3160	0.866	0.384	FREM2_MOUSE FRAS1-related extracellular matrix protein 2 OS=Mus musculus OX=10090 GN=Frem2 PE=1 SV=2
10	Q80T14	5.25e-69	259	4010	0.211	0.074	FRAS1_MOUSE Extracellular matrix organizing protein FRAS1 OS=Mus musculus OX=10090 GN=Fras1 PE=1 SV=2
11	F1Q633	9.78e-63	239	3970	0.219	0.077	F1Q633_DANRE Extracellular matrix protein FRAS1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=1
12	A0A0R4IQJ3	1.77e-62	239	4003	0.219	0.077	A0A0R4IQJ3_DANRE Extracellular matrix protein FRAS1 isoform X1 OS=Danio rerio OX=7955 GN=id:ibd5080 PE=1 SV=2
13	Q6UVK1	8.01e-33	142	2322	0.223	0.134	CSPG4_HUMAN Chondroitin sulfate proteoglycan 4 OS=Homo sapiens OX=9606 GN=CSPG4 PE=1 SV=2
14	Q8VHY0	3.82e-29	129	2327	0.204	0.122	CSPG4_MOUSE Chondroitin sulfate proteoglycan 4 OS=Mus musculus OX=10090 GN=Cspg4 PE=1 SV=3
15	Q00657	2.35e-28	127	2326	0.221	0.133	CSPG4_RAT Chondroitin sulfate proteoglycan 4 OS=Rattus norvegicus OX=10116 GN=Cspg4 PE=1 SV=2
16	A3RLX3	4.96e-21	103	2381	0.108	0.063	A3RLX3_DROME Kon-tiki OS=Drosophila melanogaster OX=7227 GN=Kon PE=1 SV=1
17	Q9VJ82	5.35e-21	103	2381	0.108	0.063	Q9VJ82_DROME Kon-tiki, isoform B OS=Drosophila melanogaster OX=7227 GN=kon PE=4 SV=3
18	Q21FF1	1.87e-07	58.5	3477	0.021	0.009	Q21FF1_SACD2 RTX toxins and related Ca2+-binding protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=Sde_3323 PE=1 SV=1
19	Q960X3	7.33e-04	46.2	514	0.027	0.074	Q960X3_DROME LD31354p OS=Drosophila melanogaster OX=7227 GN=kon PE=2 SV=1
20	Q21ML9	0.10	39.7	3474	0.027	0.011	Q21ML9_SACD2 Cadherin domain-containing protein OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) OX=203122 GN=Sde_0798 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17963 Big_9	4.3e-08	45.1	Bacterial Ig domain
2	PF16184 Cadherin_3	5.7e-180	597.8	Cadherin-like
3	PF17803 Cadherin_4	9.6e-07	40.7	Bacterial cadherin-like domain
4	PF19309 Frem_N	4.7e-96	332.0	Frem protein N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000280481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000326330	0.950	Fraser extracellular matrix complex subunit 1
2	9606.ENSP00000412940	0.896	FRAS1-related extracellular matrix protein 1
3	9606.ENSP00000389252	0.891	Nephronectin
4	9606.ENSP00000367316	0.883	Integrin alpha-8
5	9606.ENSP00000379350	0.829	Integrin beta-1
6	9606.ENSP00000376708	0.751	Von Willebrand factor A domain containing 2
7	9606.ENSP00000271588	0.727	Hemicentin-1
8	9606.ENSP00000381098	0.726	Glutamate receptor-interacting protein 1
9	9606.ENSP00000369027	0.686	Short transient receptor potential channel 4
10	9606.ENSP00000323155	0.609	DAN domain family member 5
11	9606.ENSP00000360270	0.605	Metalloendopeptidase OMA1, mitochondrial
12	9606.ENSP00000349658	0.582	X-prolyl aminopeptidase 3
13	9606.ENSP00000485357	0.580	Hemicentin-2
14	9606.ENSP00000306397	0.573	Cytochrome b-c1 complex subunit Rieske, mitochondrial
15	9606.ENSP00000312399	0.545	Coiled-coil domain-containing protein 63
16	9606.ENSP00000295666	0.542	Insulin-like growth factor-binding protein 7
17	9606.ENSP00000370377	0.540	Presequence protease, mitochondrial
18	9606.ENSP00000369976	0.538	Epidermal growth factor-like protein 6
19	9606.ENSP00000358001	0.531	Transforming acidic coiled-coil-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.907	multicellular organismal process
GO:0048856	0.906	anatomical structure development
GO:0007275	0.854	multicellular organism development
GO:0009987	0.803	cellular process
GO:0048880	0.743	sensory system development
GO:0007423	0.703	sensory organ development
GO:0150063	0.622	visual system development
GO:0001654	0.581	eye development
GO:0007155	0.380	cell adhesion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0071944	0.994	cell periphery
GO:0005576	0.987	extracellular region
GO:0030312	0.983	external encapsulating structure
GO:0043226	0.977	organelle
GO:0043227	0.971	membrane-bounded organelle
GO:0031012	0.970	extracellular matrix
GO:0062023	0.950	collagen-containing extracellular matrix
GO:0005615	0.844	extracellular space
GO:0005604	0.511	basement membrane
GO:0031982	0.458	vesicle
GO:0043230	0.411	extracellular organelle
GO:1903561	0.400	extracellular vesicle
GO:0070062	0.387	extracellular exosome
GO:0016020	0.369	membrane
GO:0005886	0.321	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]