StarFunc result for job id Q5T011

User Input

>input (1400 residues)
MASERPEPEVEEAGQVFLLMKKDYRISRNVRLAWFLSHLHQTVQATPQEMLLQSEQELEV
LSVLPPGWQPDEPVVPRPFLLVPSTRVTFLAWQYRFVIELDLSPSTGIVDDSTGEILFDE
VFHALSRCLGGLLRPFRVPGSCIDFQPEIYVTIQAYSSIIGLQSHQVLVQGCLLDPSQRE
VFLQQIYEQLCLFEDKVATMLQQQYDPQSQAEDQSPDSGDLLGRKVGVSMVTADLGLVSM
IRQGILALQLLPSNSSAGIIVITDGVTSVPDVAVCETLLNQLRSGTVACSFVQVGGVYSY
DCSFGHVPNVELMKFIAMATFGSYLSTCPEPEPGNLGLTVYHRAFLLYSFLRSGEALNPE
YYCGSQHRLFNEHLVSASSNPALALRRKKHTEKEVPADLVSTVSVRLREGYSVREVTLAK
GGSQLEVKLVLLWKHNMRIEYVAMAPWPLEPEGPRVTRVEVTMEGGYDILHDVSCALRQP
IRSLYRTHVIRRFWNTLQSINQTDQMLAHLQSFSSVPEHFTLPDSTKSGVPLFYIPPGST
TPVLSLQPSGSDSSHAQFAAYWKPVLSMDANSWQRWLHMHRLVLILEHDTPIPKHLHTPG
SNGRYSTIQCRISHSSLTSLLRDWSSFVLVEGYSYVKLLSSAPDQPPNSFYMVRIISKAP
CMVLRLGFPIGTPAPARHKIVSGLREEILRLRFPHRVQSKEPTPKVKRKGLGGAGGGSSP
SKSPPVLGPQQALSDRPCLVVLHKPLDKLLIRYEKLPLDYRAPFLLTLEPPGPLPLVSGR
SASSSLASLSRYLYHQRWLWSVPSGLAPALPLSAIAQLLSILTEVRLSEGFHFACSGEGI
INMVLELPIQNEPPGQAAAEEKHTCVVQYILFPPHSTSTKDSFSTDDDNDVEVEALEGDS
ELNLVTEVWVEPQYGRVGPGPGIWKHLQDLTYSEIPQALHPRDAACIGSMLSFEYLIQLC
QSKEWGPLPPEPRVSDGLDQGGDTCVHEIPFHFDLMGLLPQCQQLQMFFLLLAREPEGVP
FAEGSCPANDMVLCLLHSCLGQELSDREIPLTPVDQAAFLSEVLRRTCHVPGAEGPLLGV
HGIPKEQAVGSTQATGDSAFTSLSVGLPETLKPLISAQPPQWRCYARLVNPQHVFLTFLP
ATFSDVQRLAACGLEGPPQEETKPKFGDWSGAPSLKDLGGTGIKATKSHVPVLSVTLASD
NAQNQGELSPPFRRDLQAYAGRQASQTESADGPRTRCPVYIYSCSLEALREQMVGMQPPQ
APRDLIFRTQFLDHPSPSSAWMEPRYKEAANHCALLQEHAQRCYVRGLFRSLQQAQSVTS
QDLLTAVDACEELLQEIDITPFLLALCGHTWGLPHAPPSPGPLSPGPFSSSMEEGAEPRE
RAILASESSIETEDLSEPEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7t3aA	0.207	0.274	1.606E-9	990	0.061	0.086	7t3aA.pdb.gz	Cryo-EM structures of the human GATOR1-Rag-Ragulator complex reveal a spatial-constraint regulated GAP mechanism.
2	PDB:6cesD	0.180	0.258	4.797E-6	901	0.061	0.095	6cesD.pdb.gz	Architecture of the human GATOR1 and GATOR1-Rag GTPases complexes.
3	PDB:1m2vA	0.116	0.204	6.034E-5	705	0.059	0.116	1m2vA.pdb.gz	Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
4	PDB:6zgaA	0.110	0.187	6.034E-5	751	0.056	0.104	6zgaA.pdb.gz	Structure of the complete, membrane-assembled COPII coat reveals a complex interaction network.
5	PDB:7ad8D	0.094	0.382	2.757E-4	280	0.022	0.111	7ad8D.pdb.gz	The TFIIH subunits p44/p62 act as a damage sensor during nucleotide excision repair.
6	PDB:7zs96	0.084	0.254	3.552E-4	383	0.021	0.078	7zs96.pdb.gz	Structures of transcription preinitiation complex engaged with the +1 nucleosome.
7	PDB:6jp8F	0.100	0.138	6.522E-4	973	0.038	0.054	6jp8F.pdb.gz	Molecular Basis for Ligand Modulation of a Mammalian Voltage-Gated Ca2+Channel.
8	PDB:4nenA	0.097	0.124	8.205E-3	1063	0.031	0.041	4nenA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
9	PDB:4nehA	0.095	0.119	1.112E-2	1084	0.030	0.039	4nehA.pdb.gz	An internal ligand-bound, metastable state of a leukocyte integrin, alpha X beta 2.
10	PDB:7egb3	0.102	0.432	1.230E-2	263	0.024	0.125	7egb3.pdb.gz	Structural insights into preinitiation complex assembly on core promoters.
11	AFDB:Q8IJ77	0.045	0.045	1.312E-2	1434	0.056	0.055	Q8IJ77.pdb.gz	Q8IJ77_PLAF7 S-adenosylmethionine decarboxylase/ornithine decarboxylase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1033100 PE=3 SV=1
12	AFDB:Q7Z2Z1	0.089	0.067	1.778E-2	1910	0.116	0.085	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
13	AFDB:A0A158RFW1	0.095	0.131	1.968E-2	957	0.102	0.149	A0A158RFW1.pdb.gz	A0A158RFW1_HUMAN Alpha 1 type XXI collagen OS=Homo sapiens OX=9606 GN=COL21A1 PE=4 SV=1
14	AFDB:Q9W485	0.100	0.107	3.999E-2	1284	0.112	0.122	Q9W485.pdb.gz	INT6_DROME Integrator complex subunit 6 OS=Drosophila melanogaster OX=7227 GN=IntS6 PE=1 SV=2
15	AFDB:B7YZL9	0.045	0.044	4.655E-2	1500	0.080	0.075	B7YZL9.pdb.gz	B7YZL9_DROME Focal adhesion kinase, isoform D OS=Drosophila melanogaster OX=7227 GN=Fak PE=4 SV=1
16	AFDB:Q7SZZ4	0.037	0.041	1.158E-1	1229	0.053	0.060	Q7SZZ4.pdb.gz	Q7SZZ4_DANRE Period 1 OS=Danio rerio OX=7955 GN=per1 PE=4 SV=3
17	AFDB:F1QUT1	0.057	0.057	1.651E-1	1399	0.069	0.069	F1QUT1.pdb.gz	F1QUT1_DANRE Period circadian clock 2 OS=Danio rerio OX=7955 GN=fj43b09 PE=4 SV=3
18	AFDB:P56645	0.053	0.056	1.651E-1	1201	0.077	0.090	P56645.pdb.gz	PER3_HUMAN Period circadian protein homolog 3 OS=Homo sapiens OX=9606 GN=PER3 PE=1 SV=4
19	AFDB:Q9HCM3	0.046	0.036	1.922E-1	1950	0.084	0.061	Q9HCM3.pdb.gz	K1549_HUMAN UPF0606 protein KIAA1549 OS=Homo sapiens OX=9606 GN=KIAA1549 PE=1 SV=4
20	AFDB:Q8T3W6	0.034	0.072	2.022E-1	406	0.041	0.140	Q8T3W6.pdb.gz	Q8T3W6_DROME AT27166p OS=Drosophila melanogaster OX=7227 GN=hale PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A9C3	0.0	2548	3431	0.921	0.376	SZT2_MOUSE KICSTOR complex protein SZT2 OS=Mus musculus OX=10090 GN=Szt2 PE=1 SV=1
2	Q5T011	0.0	2848	3432	1.000	0.408	SZT2_HUMAN KICSTOR complex protein SZT2 OS=Homo sapiens OX=9606 GN=SZT2 PE=1 SV=3
3	A0A8I6G4C0	1.3	36.2	4986	0.019	0.005	A0A8I6G4C0_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
4	A0A8I6A4Z1	1.4	36.2	5003	0.019	0.005	A0A8I6A4Z1_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
5	A0A8I6A825	1.4	36.2	4952	0.019	0.005	A0A8I6A825_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
6	A0A8I6A900	1.4	36.2	4946	0.019	0.005	A0A8I6A900_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
7	Q8BRH4	2.9	35.0	4903	0.019	0.005	KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2
8	Q8NEZ4	2.9	35.0	4911	0.019	0.005	KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3
9	Q8CG76	6.5	33.5	367	0.015	0.057	ARK72_MOUSE Aflatoxin B1 aldehyde reductase member 2 OS=Mus musculus OX=10090 GN=Akr7a2 PE=1 SV=3
10	Q5JV73	8.0	33.5	1810	0.026	0.020	FRPD3_HUMAN FERM and PDZ domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FRMPD3 PE=2 SV=2
11	Q57Z55	8.2	33.5	1011	0.020	0.028	Q57Z55_TRYB2 Calcium-transporting ATPase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.27M3.570 PE=3 SV=1
12	P53304	9.4	33.1	468	0.014	0.041	SLI1_YEAST N-acetyltransferase SLI1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLI1 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003812886.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003820398.1	0.967	Integrin alpha FG-GAP repeat containing 2
2	9597.XP_003814156.1	0.966	Kaptin, actin binding protein
3	9597.XP_003821530.1	0.941	DEP domain containing 5
4	9597.XP_003829574.1	0.914	WD repeat-containing protein 59
5	9597.XP_003824856.1	0.879	Chromosome 12 open reading frame, human C12orf66
6	9597.XP_008976925.1	0.875	Meiosis regulator for oocyte development
7	9597.XP_003808860.1	0.858	WD repeat domain 24
8	9597.XP_003818858.1	0.858	NPR2-like, GATOR1 complex subunit
9	9597.XP_008969390.1	0.803	Belongs to the WD repeat SEC13 family.
10	9597.XP_003811281.1	0.779	S-adenosyl-L-methionine-binding protein that acts as an inhibitor of mTORC1 signaling via interaction with the GATOR1 and KICSTOR complexes. Acts as a sensor of S-adenosyl-L-methionine to signal methionine sufficiency to mTORC1: in presence of methionine, binds S-adenosyl-L-methionine, leading to disrupt interaction with the GATOR1 and KICSTOR complexes and promote mTORC1 signaling. Upon methionine starvation, S-adenosyl-L-methionine levels are reduced, thereby promoting the association with GATOR1 and KICSTOR, leading to inhibit mTORC1 signaling. Probably also acts as a S-adenosyl-L- [...]
11	9597.XP_008959881.1	0.779	NPR3 like, GATOR1 complex subunit
12	9597.XP_003815523.1	0.766	Ras-related GTP-binding protein C
13	9597.XP_003822655.1	0.714	Ras related GTP binding A
14	9597.XP_003822924.1	0.713	Ras-related GTP-binding protein D isoform X1
15	9597.XP_003815795.1	0.690	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 4
16	9597.XP_003822131.1	0.687	Mechanistic target of rapamycin
17	9597.XP_003826330.1	0.681	SEC13 homolog, nuclear pore and COPII coat complex component
18	9597.XP_003833312.1	0.680	Belongs to the cullin family. ProRule:PRU00330, ECO:0000256\|RuleBase:RU003829,
19	9597.XP_003807484.1	0.679	Ras related GTP binding B
20	9597.XP_003810705.1	0.673	Late endosomal/lysosomal adaptor, MAPK and MTOR activator 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009966	0.986	regulation of signal transduction
GO:0048519	0.978	negative regulation of biological process
GO:0032006	0.978	regulation of TOR signaling
GO:0050896	0.975	response to stimulus
GO:0048731	0.972	system development
GO:0023057	0.971	negative regulation of signaling
GO:0009991	0.965	response to extracellular stimulus
GO:0051716	0.962	cellular response to stimulus
GO:1903432	0.960	regulation of TORC1 signaling
GO:0032007	0.957	negative regulation of TOR signaling
GO:0009267	0.953	cellular response to starvation
GO:1904262	0.948	negative regulation of TORC1 signaling
GO:0034198	0.940	cellular response to amino acid starvation
GO:0007417	0.768	central nervous system development
GO:0051179	0.441	localization
GO:0008104	0.401	protein localization
GO:0071840	0.380	cellular component organization or biogenesis
GO:0016043	0.337	cellular component organization
GO:0021954	0.319	central nervous system neuron development
GO:0021955	0.305	central nervous system neuron axonogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0031090	0.988	organelle membrane
GO:0032991	0.981	protein-containing complex
GO:0005773	0.953	vacuole
GO:0000323	0.935	lytic vacuole
GO:0098588	0.932	bounding membrane of organelle
GO:0005764	0.884	lysosome
GO:0005774	0.875	vacuolar membrane
GO:0098852	0.610	lytic vacuole membrane
GO:0005765	0.589	lysosomal membrane
GO:0035859	0.577	Seh1-associated complex
GO:0042579	0.454	microbody
GO:0061700	0.375	GATOR2 complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]