StarFunc result for job id Q5T035

User Input

>input (196 residues)
MPGMVPPHVPPQMLNIPQTSLQAKPVAPQVPSPGGAPGQGPYPYSLSEPAPLTLDTSGKN
LTEQNSYSNIPHEGKHTPLYERSLPINPAQSGSPNHVDSAYFPGSSTSSSSDNDEGSGGA
TKYTIYWGFRATDHHVQGRDSQARGTAAHWHGGHVCSPNVFWRISHGPAQQLTFPTEQAA
PPVCPAPASRRLSAPG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Click to view	Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
	1	AFDB:P36956	0.103	0.025	6.054	1147	0.194	0.033	P36956.pdb.gz	SRBP1_HUMAN Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0C4DH52	2.17e-72	228	495	0.648	0.257	A0A0C4DH52_HUMAN Family with sequence similarity 120A (Fragment) OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=1
2	Q9NZB2	3.58e-69	229	1118	0.612	0.107	F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A PE=1 SV=2
3	P47991	0.58	32.7	217	0.066	0.060	RL6_CAEEL Large ribosomal subunit protein eL6 OS=Caenorhabditis elegans OX=6239 GN=rpl-6 PE=1 SV=1
4	P75894	0.96	32.0	196	0.097	0.097	RUTE_ECOLI Probable malonic semialdehyde reductase RutE OS=Escherichia coli (strain K12) OX=83333 GN=rutE PE=1 SV=1
5	Q91XZ4	2.5	31.2	772	0.117	0.030	PCDB6_MOUSE Protocadherin beta-6 OS=Mus musculus OX=10090 GN=Pcdhb6 PE=1 SV=1
6	A0A140LJ72	3.9	30.8	8478	0.122	0.003	A0A140LJ72_MOUSE Mucin 16 OS=Mus musculus OX=10090 GN=Muc16 PE=1 SV=1
7	P25439	6.2	30.0	1638	0.092	0.011	BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster OX=7227 GN=brm PE=1 SV=2
8	Q10478	6.3	30.0	475	0.071	0.029	SAM50_SCHPO SAM50-like protein SPAC17C9.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC17C9.06 PE=3 SV=1
9	A0A8I5ZTM6	7.7	29.6	1208	0.122	0.020	A0A8I5ZTM6_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
10	A0A8I6GMK8	9.6	29.6	1214	0.122	0.020	A0A8I6GMK8_RAT [histone H3]-trimethyl-L-lysine(27) demethylase OS=Rattus norvegicus OX=10116 GN=Uty PE=3 SV=1
11	Q9P7T4	9.8	29.6	1019	0.066	0.013	MRC1_SCHPO Mediator of replication checkpoint protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrc1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000280020	0.681	Protein hinderin
2	9606.ENSP00000376910	0.653	Leucine rich repeats and IQ motif containing 1
3	9606.ENSP00000376268	0.556	SEC14-like protein 1
4	9606.ENSP00000357051	0.541	Peroxisomal biogenesis factor 19
5	9606.ENSP00000330753	0.519	Bromodomain and WD repeat-containing protein 1
6	9606.ENSP00000452796	0.518	Pseudopodium-enriched atypical kinase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:1901363	0.991	heterocyclic compound binding
GO:0097159	0.991	organic cyclic compound binding
GO:0005515	0.991	protein binding
GO:0003676	0.982	nucleic acid binding
GO:0001221	0.521	transcription coregulator binding
GO:0032810	0.520	sterol response element binding
GO:0004879	0.514	nuclear receptor activity
GO:0001228	0.418	DNA-binding transcription activator activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.974	cellular process
GO:0065007	0.967	biological regulation
GO:0050789	0.892	regulation of biological process
GO:0050794	0.877	regulation of cellular process
GO:0032501	0.627	multicellular organismal process
GO:0050896	0.421	response to stimulus
GO:0008152	0.385	metabolic process
GO:0071840	0.349	cellular component organization or biogenesis
GO:0060255	0.343	regulation of macromolecule metabolic process
GO:0071704	0.335	organic substance metabolic process
GO:0080090	0.323	regulation of primary metabolic process
GO:0051171	0.323	regulation of nitrogen compound metabolic process
GO:0044238	0.304	primary metabolic process
GO:0048518	0.304	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	0.996	intracellular anatomical structure
GO:0031981	0.986	nuclear lumen
GO:0005829	0.984	cytosol
GO:0005654	0.984	nucleoplasm
GO:0030054	0.421	cell junction
GO:0005783	0.399	endoplasmic reticulum
GO:0005789	0.391	endoplasmic reticulum membrane
GO:0005635	0.387	nuclear envelope
GO:0000139	0.387	Golgi membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]