StarFunc result for job id Q5T0F9

User Input

>input (858 residues)
MMPGPRPRKGPQARGQGVAAAKQMGLFMEFGPEDMLLGMDEAEDDEDLEAELLALTGEAQ
TTGKKPAPKGQAPLPMAHIEKLAADCMRDVEEEEEEEGLEEDAELLTELQEVLGVDEETE
PLDGDEVADPGGSEEENGLEDTEPPVQTAVLTASAPAAQAGASQGLHALLEERIHNYREA
AASAKEAGEAAKARRCERGLKTLESQLASVRRGRKINEDEIPPPVALGKRPLAPQEPANR
SPETDPPAPPALESDNPSQPETSLPGISAQPVSDLDPDPRALLSSRQREYKVAALSAKRA
GELDRARELMRIGKRFGAVLEALEKGQPVDLSAMPPAPEDLKPQQASQAPTAPSVIPPAV
ERVQPVMAPDVPATPVAPTESQTVLDALQQRLNKYREAGIQARSGGDERKARMHERIAKQ
YQDAIRAHRAGRKVNFAELPVPPGFPPIPGLESTMGVEEDAVAATLAAAEKLASAEDSAP
ADKDEDEPPGHLQGEPPAQAPVAKKPARPTVPSSQRLPEPRASSSKESPSPSVREQLALL
EARKLQYQRAALQAKRSQDLEQAKAYLRVAKWLEAQIIQARSGRPVDLSKVPSPLTDEEG
DFILIHHEDLRLSQKAEEVYAQLQKMLLEQQEKCLLFSKQFMHQGNVAETTRFEKLAQDR
KKQLEILQLAQAQGLDPPTHHFELKTFQTVRIFSELNSTEMHLIIVRGMNLPAPPGVTPD
DLDAFVRFEFHYPNSDQAQKSKTAVVKNTNSPEFDQLFKLNINRNHRGFKRVIQSKGIKF
EIFHKGSFFRSDKLVGTAHLKLERLENECEIREIVEVLDGRKPTGGKLEVKVRLREPLSG
QDVQMVTENWLVLEPRGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5FVK6	0.436	0.440	0.000	850	0.805	0.813	Q5FVK6.pdb.gz	C2D1B_RAT Coiled-coil and C2 domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Cc2d1b PE=1 SV=2
2	AFDB:Q5T0F9	1.000	1.000	0.000	858	1.000	1.000	Q5T0F9.pdb.gz	C2D1B_HUMAN Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B PE=1 SV=1
3	AFDB:Q9VKJ9	0.261	0.273	6.143E-62	816	0.336	0.353	Q9VKJ9.pdb.gz	C2D1_DROME Coiled-coil and C2 domain-containing protein 1-like OS=Drosophila melanogaster OX=7227 GN=l(2)gd1 PE=1 SV=1
4	AFDB:Q9EPQ2	0.153	0.101	4.433E-11	1331	0.147	0.095	Q9EPQ2.pdb.gz	RPGR1_MOUSE X-linked retinitis pigmentosa GTPase regulator-interacting protein 1 OS=Mus musculus OX=10090 GN=Rpgrip1 PE=1 SV=1
5	AFDB:Q6NPS1	0.080	0.062	2.251E-9	1171	0.126	0.092	Q6NPS1.pdb.gz	Q6NPS1_ARATH At1g61690 OS=Arabidopsis thaliana OX=3702 GN=At1g61690 PE=1 SV=1
6	AFDB:Q8NB66	0.118	0.048	2.868E-8	2214	0.117	0.045	Q8NB66.pdb.gz	UN13C_HUMAN Protein unc-13 homolog C OS=Homo sapiens OX=9606 GN=UNC13C PE=2 SV=3
7	PDB:4rj9A	0.123	0.603	5.250E-8	161	0.040	0.211	4rj9A.pdb.gz
8	AFDB:Q09459	0.145	0.097	8.203E-8	1322	0.120	0.078	Q09459.pdb.gz	FTM_CAEEL Protein fantom OS=Caenorhabditis elegans OX=6239 GN=mks-5 PE=2 SV=4
9	PDB:5ixcA	0.122	0.151	4.296E-7	684	0.022	0.028	5ixcA.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
10	PDB:5a52A	0.122	0.625	6.327E-7	154	0.029	0.162	5a52A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
11	AFDB:E9QHV7	0.136	0.091	6.712E-7	1342	0.147	0.094	E9QHV7.pdb.gz
12	PDB:5a50A	0.122	0.576	7.067E-7	165	0.028	0.145	5a50A.pdb.gz	Calcium-Dependent Oligomerization of Car Proteins at Cell Membrane Modulates Aba Signaling.
13	PDB:5izrC	0.122	0.156	1.100E-6	659	0.022	0.029	5izrC.pdb.gz	Structure of Human GIVD Cytosolic Phospholipase A2 Reveals Insights into Substrate Recognition.
14	AFDB:B7Z0K1	0.115	0.088	1.104E-6	1137	0.124	0.093	B7Z0K1.pdb.gz	B7Z0K1_DROME Bitesize, isoform H OS=Drosophila melanogaster OX=7227 GN=btsz PE=4 SV=1
15	PDB:1cjyA	0.123	0.163	1.620E-6	633	0.021	0.028	1cjyA.pdb.gz	Crystal structure of human cytosolic phospholipase A2 reveals a novel topology and catalytic mechanism.
16	AFDB:Q62768	0.122	0.067	1.817E-6	1735	0.125	0.062	Q62768.pdb.gz	UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus OX=10116 GN=Unc13a PE=1 SV=1
17	PDB:5iz5B	0.128	0.146	2.258E-6	746	0.026	0.029	5iz5B.pdb.gz
18	PDB:5iz5A	0.119	0.134	9.002E-6	757	0.026	0.029	5iz5A.pdb.gz
19	PDB:6kz8A	0.121	0.132	3.589E-5	784	0.030	0.033	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
20	PDB:3nsjA	0.124	0.197	5.586E-5	530	0.024	0.040	3nsjA.pdb.gz	The structural basis for membrane binding and pore formation by lymphocyte perforin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	H0Y517	0.0	1222	628	0.712	0.973	H0Y517_HUMAN Coiled-coil and C2 domain containing 1B (Fragment) OS=Homo sapiens OX=9606 GN=CC2D1B PE=1 SV=1
2	H7C1U3	0.0	1331	672	0.782	0.999	H7C1U3_HUMAN Coiled-coil and C2 domain containing 1B (Fragment) OS=Homo sapiens OX=9606 GN=CC2D1B PE=1 SV=2
3	Q5FVK6	0.0	1244	850	0.803	0.811	C2D1B_RAT Coiled-coil and C2 domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Cc2d1b PE=1 SV=2
4	Q5T0F9	0.0	1719	858	1.000	1.000	C2D1B_HUMAN Coiled-coil and C2 domain-containing protein 1B OS=Homo sapiens OX=9606 GN=CC2D1B PE=1 SV=1
5	Q66HA5	0.0	634	941	0.444	0.405	C2D1A_RAT Coiled-coil and C2 domain-containing protein 1A OS=Rattus norvegicus OX=10116 GN=Cc2d1a PE=1 SV=2
6	Q6P1N0	0.0	619	951	0.458	0.413	C2D1A_HUMAN Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A PE=1 SV=1
7	Q8BRN9	0.0	1237	848	0.802	0.811	C2D1B_MOUSE Coiled-coil and C2 domain-containing protein 1B OS=Mus musculus OX=10090 GN=Cc2d1b PE=1 SV=1
8	Q8K1A6	0.0	611	943	0.436	0.397	C2D1A_MOUSE Coiled-coil and C2 domain-containing protein 1A OS=Mus musculus OX=10090 GN=Cc2d1a PE=1 SV=2
9	Q9VKJ9	6.59e-116	374	816	0.319	0.336	C2D1_DROME Coiled-coil and C2 domain-containing protein 1-like OS=Drosophila melanogaster OX=7227 GN=l(2)gd1 PE=1 SV=1
10	Q15111	0.002	44.7	1095	0.023	0.018	PLCL1_HUMAN Inactive phospholipase C-like protein 1 OS=Homo sapiens OX=9606 GN=PLCL1 PE=1 SV=3
11	Q3USB7	0.002	44.3	1096	0.023	0.018	PLCL1_MOUSE Inactive phospholipase C-like protein 1 OS=Mus musculus OX=10090 GN=Plcl1 PE=1 SV=3
12	Q62688	0.002	43.9	1096	0.023	0.018	PLCL1_RAT Inactive phospholipase C-like protein 1 OS=Rattus norvegicus OX=10116 GN=Plcl1 PE=1 SV=1
13	Q8K394	0.005	43.1	1128	0.026	0.020	PLCL2_MOUSE Inactive phospholipase C-like protein 2 OS=Mus musculus OX=10090 GN=Plcl2 PE=1 SV=2
14	Q9UPR0	0.007	42.7	1127	0.026	0.020	PLCL2_HUMAN Inactive phospholipase C-like protein 2 OS=Homo sapiens OX=9606 GN=PLCL2 PE=1 SV=2
15	A0A8I6A999	0.018	41.2	1193	0.038	0.028	A0A8I6A999_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=1
16	D3Z8G3	0.021	41.2	1268	0.038	0.026	D3Z8G3_RAT Rpgrip1-like OS=Rattus norvegicus OX=10116 GN=Rpgrip1l PE=3 SV=2
17	Q8CG73	0.31	37.4	1264	0.034	0.023	FTM_MOUSE Protein fantom OS=Mus musculus OX=10090 GN=Rpgrip1l PE=1 SV=2
18	Q07381	0.56	36.2	788	0.035	0.038	TSR1_YEAST Ribosome biogenesis protein TSR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TSR1 PE=1 SV=1
19	A8T6P4	0.81	35.8	838	0.024	0.025	MYRIP_DANRE Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1
20	H2LIC9	1.2	35.4	659	0.026	0.033	H2LIC9_ORYLA Phosphoinositide phospholipase C OS=Oryzias latipes OX=8090 GN=PLCZ1 PE=4 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00168 C2	6.2e-06	37.8	C2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360642

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217402	0.954	Charged multivesicular body protein 4b
2	9606.ENSP00000324205	0.939	Charged multivesicular body protein 4a
3	9606.ENSP00000369703	0.907	Tubulin beta-2A chain
4	9606.ENSP00000380794	0.903	Charged multivesicular body protein 7
5	9606.ENSP00000217133	0.900	Tubulin beta-1 chain
6	9606.ENSP00000248437	0.900	Tubulin alpha-4A chain
7	9606.ENSP00000259818	0.900	Tubulin beta-2B chain
8	9606.ENSP00000264071	0.900	Tubulin beta-4A chain
9	9606.ENSP00000301071	0.900	Tubulin alpha-1A chain
10	9606.ENSP00000301072	0.900	Tubulin alpha-1C chain
11	9606.ENSP00000309431	0.900	Tubulin beta-8 chain-like protein LOC260334
12	9606.ENSP00000318197	0.900	Tubulin alpha-3E chain
13	9606.ENSP00000318697	0.900	Tubulin beta-6 chain
14	9606.ENSP00000333326	0.900	Tubulin alpha-8 chain
15	9606.ENSP00000336799	0.900	Tubulin alpha-1B chain
16	9606.ENSP00000341289	0.900	Tubulin beta-4B chain
17	9606.ENSP00000369784	0.900	Tubulin alpha chain-like 3
18	9606.ENSP00000456206	0.900	Tubulin beta-8 chain
19	9606.ENSP00000438399	0.851	IST1 homolog
20	9606.ENSP00000297265	0.832	Charged multivesicular body protein 4c

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901363	0.731	heterocyclic compound binding
GO:0097159	0.731	organic cyclic compound binding
GO:0003676	0.626	nucleic acid binding
GO:0001217	0.447	DNA-binding transcription repressor activity
GO:0001227	0.434	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000977	0.371	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.312	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0031324	0.974	negative regulation of cellular metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0051171	0.965	regulation of nitrogen compound metabolic process
GO:0010605	0.965	negative regulation of macromolecule metabolic process
GO:0045892	0.946	negative regulation of DNA-templated transcription
GO:0006357	0.939	regulation of transcription by RNA polymerase II
GO:0000122	0.821	negative regulation of transcription by RNA polymerase II
GO:0009987	0.673	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.996	nucleoplasm
GO:0012505	0.993	endomembrane system
GO:0031967	0.865	organelle envelope
GO:0043232	0.708	intracellular non-membrane-bounded organelle
GO:0005737	0.571	cytoplasm
GO:0005635	0.483	nuclear envelope
GO:0005829	0.375	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]