StarFunc result for job id Q5T0N1

User Input

>input (1121 residues)
MEQVPSAGRLVQITVTEGYDLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNF
TSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKEEKTLILGQAVVDLLPLLEGQSS
FQTTVPLHPVQGSPLETPRSSAKQCSLEVKVLVAEPLLTTAQISGGNLLKVTLEAAYSVP
ESFIPTGPGQNYMVGLQVPSLGEKDYPILFKNGTLKLGGEREPVPRPKKWPIANILAPGA
NNIPDAFIVGGPYEEEEGELNHPEDSEFRNQAECIKKRIIWDLESRCYLDPSAVVSFQKR
IADCRLWPVEITRVPLVTIPKGKAGKTEKTDEEAQLSFHGVAYVNMVPLLYPGVKRIRGA
FHVYPYLDSVVHEKTKCLLSLFRDIGHHLIHNNKIGGINSLLSKQAVSKNLKEDKPVKEK
DIDGRPRPGDVQAPSIKSQSSDTPLEGEPPLSHNPEGQQYVEAGTYIVLEIQLDKALVPK
RMPEELARRVKEMIPPRPPLTRRTGGAQKAMSDYHIQIKNISRAILDEYYRMFGKQVAKL
ESDMDSETLEEQKCQLSYELNCSGKYFAFKEQLKHAVVKIVRDKYLKTTSFESQEELQTF
ISELYVFLVDQMHVALNQTMPDDVQGTVATIYTSSEQLQLFAFEAEVNENFEMAAAYYKE
RLVREPQNLDHWLDYGAFCLLTEDNIKAQECFQKALSLNQSHIHSLLLCGVLAVLLENYE
QAEIFFEDATCLEPTNVVAWTLLGLYYEIQNNDIRMEMAFHEASKQLQARMLQAQVTKQK
STGVEDTEERGKRESSLGPWGITNGSATAIKVEAPAGPGAALSILDKFLEESSKLQSDSQ
EPILTTQTWDPSISQKPSNTFIKEIPTKKEASKCQDSSALLHPGLHYGVSQTTTIFMETI
HFLMKVKAVQYVHRVLAHELLCPQGGPSCEYYLVLAQTHILKKNFAKAEEYLQQAAQMDY
LNPNVWGLKGHLYFLSGNHSEAKACYERTISFVVDASEMHFIFLRLGLIYLEEKEYEKAK
KTYMQACKRSPSCLTWLGLGIACYRLEELTEAEDALSEANALNNYNAEVWAYLALVCLKV
GRQLEAEQAYKYMIKLKLKDEALLAEIHTLQETVGFGNPSF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YVL2	0.870	0.855	0.000	1141	0.807	0.793	D3YVL2.pdb.gz	CFA70_MOUSE Cilia- and flagella-associated protein 70 OS=Mus musculus OX=10090 GN=Cfap70 PE=1 SV=2
2	AFDB:Q5T0N1	1.000	1.000	0.000	1121	1.000	1.000	Q5T0N1.pdb.gz	CFA70_HUMAN Cilia- and flagella-associated protein 70 OS=Homo sapiens OX=9606 GN=CFAP70 PE=1 SV=3
3	AFDB:Q9M8Y0	0.188	0.213	2.415E-13	977	0.071	0.082	Q9M8Y0.pdb.gz	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
4	AFDB:O18158	0.176	0.172	3.871E-13	1151	0.067	0.065	O18158.pdb.gz	OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans OX=6239 GN=ogt-1 PE=1 SV=2
5	AFDB:A0A2R8PZ91	0.177	0.177	5.008E-13	1119	0.069	0.069	A0A2R8PZ91.pdb.gz
6	AFDB:Q7KJA9	0.176	0.186	5.696E-13	1059	0.062	0.066	Q7KJA9.pdb.gz	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
7	AFDB:Q57WP4	0.190	0.300	1.132E-12	673	0.070	0.117	Q57WP4.pdb.gz	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
8	AFDB:Q7ZWU1	0.108	0.205	1.486E-11	543	0.062	0.129	Q7ZWU1.pdb.gz	STIP1_XENLA Stress-induced-phosphoprotein 1 OS=Xenopus laevis OX=8355 GN=stip1 PE=2 SV=1
9	AFDB:Q07617	0.139	0.160	3.082E-11	926	0.087	0.105	Q07617.pdb.gz	SPAG1_HUMAN Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3
10	AFDB:Q5ADP3	0.171	0.176	4.161E-11	1080	0.069	0.071	Q5ADP3.pdb.gz	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
11	PDB:7ntfA	0.165	0.195	1.475E-9	918	0.056	0.069	7ntfA.pdb.gz
12	PDB:8a3tJ	0.157	0.304	2.808E-9	509	0.065	0.143	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
13	PDB:4bujB	0.177	0.149	4.906E-9	1367	0.075	0.061	4bujB.pdb.gz
14	PDB:5dseA	0.148	0.270	5.345E-9	537	0.066	0.138	5dseA.pdb.gz
15	PDB:7qe7J	0.168	0.336	6.080E-9	510	0.071	0.157	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
16	PDB:7qdrB	0.131	0.122	8.210E-9	1212	0.070	0.065	7qdrB.pdb.gz
17	PDB:7qe7K	0.162	0.305	8.570E-9	531	0.063	0.134	7qe7K.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:7qe7Y	0.133	0.257	9.338E-9	502	0.076	0.169	7qe7Y.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
19	PDB:7dhgC	0.132	0.264	1.062E-8	470	0.048	0.115	7dhgC.pdb.gz
20	PDB:6bq1B	0.146	0.208	1.374E-8	728	0.059	0.091	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3YVL2	0.0	1851	1141	0.816	0.802	CFA70_MOUSE Cilia- and flagella-associated protein 70 OS=Mus musculus OX=10090 GN=Cfap70 PE=1 SV=2
2	Q5T0N1	0.0	2323	1121	1.000	1.000	CFA70_HUMAN Cilia- and flagella-associated protein 70 OS=Homo sapiens OX=9606 GN=CFAP70 PE=1 SV=3
3	A8ITV9	8.00e-18	92.0	1104	0.073	0.074	CFA70_CHLRE Cilia- and flagella-associated protein 70 OS=Chlamydomonas reinhardtii OX=3055 GN=CFAP70 PE=1 SV=1
4	O77033	5.13e-07	56.6	1390	0.045	0.037	CYC8_DICDI General transcriptional corepressor trfA OS=Dictyostelium discoideum OX=44689 GN=trfA PE=2 SV=1
5	O60184	1.40e-05	52.0	1102	0.032	0.033	CYC8_SCHPO General transcriptional corepressor ssn6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ssn6 PE=1 SV=1
6	Q5ADP3	3.56e-05	50.4	1080	0.039	0.041	Q5ADP3_CANAL Transcription regulator OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=SSN6 PE=1 SV=1
7	Q14690	9.37e-05	49.3	1871	0.042	0.025	RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3
8	P14922	2.84e-04	47.8	966	0.026	0.030	CYC8_YEAST General transcriptional corepressor CYC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CYC8 PE=1 SV=2
9	Q4GYI6	3.96e-04	47.0	907	0.028	0.034	Q4GYI6_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.3910 PE=4 SV=1
10	Q6NS46	4.66e-04	47.0	1862	0.041	0.025	RRP5_MOUSE Protein RRP5 homolog OS=Mus musculus OX=10090 GN=Pdcd11 PE=1 SV=2
11	Q57WP4	0.001	45.4	673	0.084	0.140	Q57WP4_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27M11.910 PE=4 SV=1
12	Q06AN9	0.002	44.7	717	0.030	0.047	CD27A_ARATH Cell division cycle protein 27 homolog A OS=Arabidopsis thaliana OX=3702 GN=CDC27A PE=1 SV=2
13	Q9FPW0	0.006	43.1	782	0.043	0.061	Q9FPW0_CHLRE Intraflagellar transport particle protein IFT88 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT88 PE=2 SV=1
14	P16522	0.008	42.7	626	0.025	0.045	CDC23_YEAST Anaphase-promoting complex subunit CDC23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC23 PE=1 SV=1
15	Q6P3X3	0.014	42.0	843	0.029	0.039	TTC27_HUMAN Tetratricopeptide repeat protein 27 OS=Homo sapiens OX=9606 GN=TTC27 PE=1 SV=1
16	P12204	0.015	40.0	168	0.029	0.190	YCF3_TOBAC Photosystem I assembly protein Ycf3 OS=Nicotiana tabacum OX=4097 GN=ycf3 PE=1 SV=1
17	P73091	0.015	41.6	398	0.023	0.065	P73091_SYNY3 Slr2048 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr2048 PE=4 SV=1
18	Q62018	0.023	41.6	1173	0.034	0.032	CTR9_MOUSE RNA polymerase-associated protein CTR9 homolog OS=Mus musculus OX=10090 GN=Ctr9 PE=1 SV=2
19	P61843	0.024	39.3	168	0.028	0.185	YCF3_ARATH Photosystem I assembly protein Ycf3 OS=Arabidopsis thaliana OX=3702 GN=ycf3 PE=1 SV=1
20	P0C516	0.031	38.9	170	0.030	0.200	YCF3_ORYSA Photosystem I assembly protein Ycf3 OS=Oryza sativa OX=4530 GN=ycf3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.037	25.6	Anaphase-promoting complex, cyclosome, subunit 3
2	PF01525 Rota_NS26	8e+02	11.4	Rotavirus NS26
3	PF08238 Sel1	7.2	18.7	Sel1 repeat
4	PF00515 TPR_1	3e-16	69.7	Tetratricopeptide repeat
5	PF13414 TPR_11	0.0048	27.9	TPR repeat
6	PF13424 TPR_12	4.3e-08	44.7	Tetratricopeptide repeat
7	PF13428 TPR_14	6.6e-11	53.0	Tetratricopeptide repeat
8	PF13432 TPR_16	2e-05	36.4	Tetratricopeptide repeat
9	PF13431 TPR_17	4.6	18.9	Tetratricopeptide repeat
10	PF14559 TPR_19	0.0012	30.6	Tetratricopeptide repeat
11	PF07719 TPR_2	3.4e-14	62.8	Tetratricopeptide repeat
12	PF09976 TPR_21	99	14.1	Tetratricopeptide repeat-like domain
13	PF13174 TPR_6	13	17.8	Tetratricopeptide repeat
14	PF13176 TPR_7	0.0051	27.8	Tetratricopeptide repeat
15	PF13181 TPR_8	6.5e-12	55.7	Tetratricopeptide repeat
16	PF13371 TPR_9	12	17.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310829

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000374490	0.908	Dynein heavy chain 17, axonemal
2	9606.ENSP00000333363	0.906	Dynein heavy chain 8, axonemal
3	9606.ENSP00000458355	0.905	Dynein heavy chain 2, axonemal
4	9606.ENSP00000318429	0.839	Coiled-coil domain-containing protein 114
5	9606.ENSP00000400252	0.821	Dynein intermediate chain 2, axonemal
6	9606.ENSP00000452037	0.744	Dynein light chain 1, axonemal
7	9606.ENSP00000265104	0.737	Dynein heavy chain 5, axonemal
8	9606.ENSP00000376910	0.736	Leucine rich repeats and IQ motif containing 1
9	9606.ENSP00000261383	0.731	Dynein heavy chain 3, axonemal
10	9606.ENSP00000401514	0.726	Dynein heavy chain 1, axonemal
11	9606.ENSP00000342518	0.723	Solute carrier family 35 member F4
12	9606.ENSP00000251241	0.714	Probable ATP-dependent RNA helicase DHX40
13	9606.ENSP00000351770	0.712	Forkhead-associated domain-containing protein 1
14	9606.ENSP00000480538	0.697	Dynein intermediate chain 1, axonemal
15	9606.ENSP00000337804	0.689	Sperm-associated antigen 17
16	9606.ENSP00000390932	0.678	Leucine-rich repeat-containing protein 23
17	9606.ENSP00000339449	0.670	Cilia- and flagella-associated protein 52
18	9606.ENSP00000348086	0.668	Protein FAM227A
19	9606.ENSP00000357079	0.658	Cilia and flagella associated protein 45
20	9606.ENSP00000373347	0.654	SLIT-ROBO Rho GTPase-activating protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0003341	0.996	cilium movement
GO:0006996	0.988	organelle organization
GO:0044782	0.979	cilium organization
GO:0060271	0.967	cilium assembly
GO:0065007	0.337	biological regulation
GO:0050789	0.302	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005930	0.999	axoneme
GO:0036126	0.998	sperm flagellum
GO:0032991	0.955	protein-containing complex
GO:0015630	0.845	microtubule cytoskeleton
GO:0005875	0.837	microtubule associated complex
GO:0005858	0.823	axonemal dynein complex
GO:0005576	0.786	extracellular region
GO:0005815	0.624	microtubule organizing center
GO:0005615	0.552	extracellular space
GO:0031982	0.499	vesicle
GO:0036064	0.486	ciliary basal body
GO:0065010	0.405	extracellular membrane-bounded organelle
GO:0070062	0.399	extracellular exosome
GO:0043231	0.305	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]