StarFunc result for job id Q5T0W9

User Input

>input (1011 residues)
METSSMLSSLNDECKSDNYIEPHYKEWYRVAIDILIEHGLEAYQEFLVQERVSDFLAEEE
INYILKNVQKVAQSTAHGTDDSCDDTLSSGTYWPVESDVEAPNLDLGWPYVMPGLLGGTH
IDLLFHPPRAHLLTIKETIRKMIKEARKVIALVMDIFTDVDIFKEIVEASTRGVSVYILL
DESNFNHFLNMTEKQGCSVQRLRNIRVRTVKGQDYLSKTGAKFHGKMEQKFLLVDCQKVM
YGSYSYMWSFEKAHLSMVQIITGQLVESFDEEFRTLYARSCVPSSFAQEESARVKHGKAL
WENGTYQHSVSSLASVSSQRNLFGRQDKIHKLDSSYFKNRGIYTLNEHDKYNIRSHGYKP
HFVPNFNGPNAIRQFQPNQINENWKRHSYAGEQPETVPYLLLNRALNRTNNPPGNWKKPS
DSLSVASSSREGYVSHHNTPAQSFANRLAQRKTTNLADRNSNVRRSFNGTDNHIRFLQQR
MPTLEHTTKSFLRNWRIESYLNDHSEATPDSNGSALGDRFEGYDNPENLKANALYTHSRL
RSSLVFKPTLPEQKEVNSCTTGSSNSTIIGSQGSETPKEVPDTPTNVQHLTDKPLPESIP
KLPLQSEAPKMHTLQVPENHSVALNQTTNGHTESNNYIYKTLGVNKQTENLKNQQTENLL
KRRSFPLFDNSKANLDPGNSKHYVYSTLTRNRVRQPEKPKEDLLKSSKSMHNVTHNLEED
EEEVTKRNSPSGTTTKSVSIAALLDVNKEESNKELASKKEVKGSPSFLKKGSQKLRSLLS
LTPDKKENLSKNKAPAFYRLCSSSDTLVSEGEENQKPKKSDTKVDSSPRRKHSSSSNSQG
SIHKSKEDVTVSPSQEINAPPDENKRTPSPGPVESKFLERAGDASAPRFNTEQIQYRDSR
EINAVVTPERRPTSSPRPTSSELLRSHSTDRRVYSRFEPFCKIESSIQPTSNMPNTSINR
PEIKSATMGNSYGRSSPLLNYNTGVYRSYQPNENKFRGFMQKFGNFIHKNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T0W9	1.000	1.000	0.000	1011	1.000	1.000	Q5T0W9.pdb.gz	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
2	AFDB:Q6ZRV2	0.262	0.226	2.654E-38	1179	0.252	0.216	Q6ZRV2.pdb.gz	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
3	PDB:6kz8A	0.115	0.145	3.649E-6	784	0.027	0.034	6kz8A.pdb.gz	Crystal structure of plant PLD alpha 1 reveals catalytic and regulatory mechanisms of eukaryotic phospholipase D.
4	PDB:1xdpA	0.116	0.166	3.480E-5	687	0.023	0.033	1xdpA.pdb.gz	Crystal structure of a polyphosphate kinase and its implications for polyphosphate synthesis
5	PDB:7v55A	0.120	0.152	2.191E-4	781	0.022	0.028	7v55A.pdb.gz	Structural insights into PA3488-mediated inactivation of Pseudomonas aeruginosa PldA.
6	PDB:7wdkA	0.105	0.121	2.467E-4	867	0.018	0.021	7wdkA.pdb.gz
7	PDB:7v53A	0.106	0.114	7.621E-4	930	0.020	0.022	7v53A.pdb.gz
8	PDB:1q32B	0.083	0.182	8.185E-3	420	0.014	0.033	1q32B.pdb.gz
9	AFDB:Q16825	0.046	0.042	1.253E-2	1174	0.111	0.095	Q16825.pdb.gz	PTN21_HUMAN Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2
10	PDB:2ymbD	0.097	0.344	1.482E-2	231	0.016	0.069	2ymbD.pdb.gz	Escrt-III Binding Protein Mitd1 is Involved in Cytokinesis and Has an Unanticipated Pld Fold that Binds Membranes.
11	AFDB:Q499E5	0.049	0.043	1.687E-2	926	0.138	0.151	Q499E5.pdb.gz	STOX2_MOUSE Storkhead-box protein 2 OS=Mus musculus OX=10090 GN=Stox2 PE=2 SV=2
12	AFDB:Q9GV71	0.043	0.032	2.555E-2	1543	0.120	0.078	Q9GV71.pdb.gz	Q9GV71_DICDI MAP kinase phosphatase OS=Dictyostelium discoideum OX=44689 GN=mkpA PE=4 SV=1
13	AFDB:A0A096LNW1	0.034	0.036	2.877E-2	954	0.102	0.108	A0A096LNW1.pdb.gz	A0A096LNW1_HUMAN DNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=ATRX PE=1 SV=1
14	AFDB:P07663	0.053	0.047	3.053E-2	1224	0.095	0.078	P07663.pdb.gz	PER_DROME Period circadian protein OS=Drosophila melanogaster OX=7227 GN=per PE=1 SV=2
15	AFDB:A8JNK1	0.049	0.044	4.909E-2	1241	0.128	0.104	A8JNK1.pdb.gz	A8JNK1_DROME Ensconsin, isoform F OS=Drosophila melanogaster OX=7227 GN=ens PE=1 SV=1
16	AFDB:O14100	0.046	0.049	6.605E-2	938	0.105	0.113	O14100.pdb.gz	ZDS1_SCHPO Protein zds1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=zds1 PE=1 SV=2
17	PDB:3jcjf	0.072	0.131	6.934E-2	509	0.026	0.051	3jcjf.pdb.gz	Structures of ribosome-bound initiation factor 2 reveal the mechanism of subunit association.
18	AFDB:A0A0A0MSA4	0.046	0.045	7.009E-2	1046	0.119	0.115	A0A0A0MSA4.pdb.gz	A0A0A0MSA4_HUMAN Erythrocyte membrane protein band 4.1 like 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=1
19	PDB:1f6mA	0.046	0.102	9.900E-2	320	0.015	0.047	1f6mA.pdb.gz	Twists in catalysis: alternating conformations of Escherichia coli thioredoxin reductase.
20	PDB:6tnmA	0.051	0.067	2.881E-1	719	0.013	0.018	6tnmA.pdb.gz	Insights into the stability and substrate specificity of the E. coli aerobic beta-oxidation trifunctional enzyme complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T0W9	0.0	2100	1011	1.000	1.000	FA83B_HUMAN Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1
2	Q6ZRV2	2.40e-79	284	1179	0.138	0.119	FA83H_HUMAN Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3
3	A6ND36	3.15e-54	206	823	0.108	0.132	FA83G_HUMAN Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2
4	Q9BQN1	2.82e-52	199	747	0.105	0.142	FA83C_HUMAN Protein FAM83C OS=Homo sapiens OX=9606 GN=FAM83C PE=1 SV=3
5	Q9H4H8	2.06e-49	187	585	0.102	0.176	FA83D_HUMAN Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=3
6	A0A087WXK8	3.46e-49	187	615	0.102	0.167	A0A087WXK8_HUMAN Chromosome 20 open reading frame 129 OS=Homo sapiens OX=9606 GN=FAM83D PE=1 SV=1
7	Q8NEG4	1.57e-46	177	500	0.103	0.208	FA83F_HUMAN Protein FAM83F OS=Homo sapiens OX=9606 GN=FAM83F PE=1 SV=1
8	Q86UY5	3.20e-43	165	434	0.097	0.226	FA83A_HUMAN Protein FAM83A OS=Homo sapiens OX=9606 GN=FAM83A PE=1 SV=1
9	Q2M2I3	1.96e-42	164	478	0.094	0.199	FA83E_HUMAN Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03233 Cauli_AT	8.2e+02	11.3	Aphid transmission protein
2	PF07894 FAM83	5.7e-102	352.6	FAM83 A-H
3	PF13091 PLDc_2	1.4e-06	39.7	PLD-like domain
4	PF13090 PP_kinase_C	3.3e+02	12.1	Polyphosphate kinase C-terminal domain 2
5	PF11495 Regulator_TrmB	53	14.5	Archaeal transcriptional regulator TrmB

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000304078

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262320	0.853	Axin-1
2	9606.ENSP00000421689	0.753	Casein kinase I isoform alpha
3	9606.ENSP00000380044	0.744	Casein kinase I isoform epsilon
4	9606.ENSP00000251849	0.708	RAF proto-oncogene serine/threonine-protein kinase
5	9606.ENSP00000359942	0.690	Kelch-like protein 31
6	9606.ENSP00000469880	0.641	Inactive serine/threonine-protein kinase VRK3
7	9606.ENSP00000259750	0.634	Tau-tubulin kinase 1
8	9606.ENSP00000261839	0.625	Unconventional myosin-Vc
9	9606.ENSP00000259939	0.614	E3 ubiquitin-protein ligase RNF144B
10	9606.ENSP00000474246	0.606	Izumo sperm-egg fusion protein 3
11	9606.ENSP00000408002	0.604	Serine/threonine-protein kinase VRK2
12	9606.ENSP00000399075	0.603	A-kinase anchor protein inhibitor 1
13	9606.ENSP00000259782	0.593	Tubulointerstitial nephritis antigen
14	9606.ENSP00000237172	0.586	Filamin-A-interacting protein 1
15	9606.ENSP00000358966	0.561	Interphotoreceptor matrix proteoglycan 1
16	9606.ENSP00000328423	0.557	Meiotic recombination protein REC114
17	9606.ENSP00000304283	0.541	Ras-related C3 botulinum toxin substrate 3
18	9606.ENSP00000324302	0.525	Syntaxin-binding protein 6
19	9606.ENSP00000402527	0.513	Sentrin-specific protease 6
20	9606.ENSP00000359740	0.511	E3 SUMO-protein ligase ZNF451

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0036312	1.000	phosphatidylinositol 3-kinase regulatory subunit binding
GO:0019901	1.000	protein kinase binding
GO:0005154	1.000	epidermal growth factor receptor binding
GO:0036313	0.983	phosphatidylinositol 3-kinase catalytic subunit binding
GO:0003824	0.482	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.996	biological regulation
GO:0050794	0.988	regulation of cellular process
GO:0051716	0.946	cellular response to stimulus
GO:0007154	0.935	cell communication
GO:0007166	0.926	cell surface receptor signaling pathway
GO:0007173	0.921	epidermal growth factor receptor signaling pathway
GO:0008283	0.743	cell population proliferation
GO:0008152	0.330	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0016020	0.999	membrane
GO:0043229	0.956	intracellular organelle
GO:0043227	0.938	membrane-bounded organelle
GO:0005829	0.918	cytosol
GO:0005634	0.839	nucleus
GO:0043228	0.727	non-membrane-bounded organelle
GO:0043232	0.722	intracellular non-membrane-bounded organelle
GO:0005856	0.541	cytoskeleton
GO:0071944	0.501	cell periphery
GO:0070013	0.435	intracellular organelle lumen
GO:0031981	0.368	nuclear lumen
GO:0005886	0.344	plasma membrane
GO:0005654	0.323	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]