StarFunc result for job id Q5T160

User Input

>input (578 residues)
MACGFRRAIACQLSRVLNLPPENLITSISAVPISQKEEVADFQLSVDSLLEKDNDHSRPD
IQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFS
GLPQKKIVVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVIRINYLGDWGMQFGL
LGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKSVAKAAQEFFQRLELGDVQALSL
WQKFRDLSIEEYIRVYKRLGVYFDEYSGESFYREKSQEVLKLLESKGLLLKTIKGTAVVD
LSGNGDPSSICTVMRSDGTSLYATRDLAAAIDRMDKYNFDTMIYVTDKGQKKHFQQVFQM
LKIMGYDWAERCQHVPFGVVQGMKTRRGDVTFLEDVLNEIQLRMLQNMASIKTTKELKNP
QETAERVGLAALIIQDFKGLLLSDYKFSWDRVFQSRGDTGVFLQYTHARLHSLEETFGCG
YLNDFNTACLQEPQSVSILQHLLRFDEVLYKSSQDFQPRHIVSYLLTLSHLAAVAHKTLQ
IKDSPPEVAGARLHLFKAVRSVLANGMKLLGITPVCRM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T160	1.000	1.000	7.725E-91	578	1.000	1.000	Q5T160.pdb.gz	SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1
2	AFDB:Q3U186	0.990	0.990	1.186E-80	578	0.865	0.865	Q3U186.pdb.gz	SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Rars2 PE=1 SV=1
3	AFDB:A5WVY0	0.968	0.938	3.207E-61	597	0.569	0.551	A5WVY0.pdb.gz
4	AFDB:Q558Z0	0.919	0.903	1.383E-48	589	0.400	0.392	Q558Z0.pdb.gz	SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=argS1 PE=3 SV=1
5	AFDB:Q05506	0.915	0.873	4.271E-48	607	0.388	0.369	Q05506.pdb.gz	SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR341C PE=1 SV=1
6	AFDB:P38714	0.901	0.813	1.971E-45	643	0.382	0.344	P38714.pdb.gz	SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSR1 PE=3 SV=3
7	PDB:1f7uA	0.905	0.865	7.280E-45	606	0.389	0.371	1f7uA.pdb.gz	tRNA aminoacylation by arginyl-tRNA synthetase: induced conformations during substrates binding
8	AFDB:O74781	0.883	0.828	9.995E-45	618	0.377	0.353	O74781.pdb.gz	SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrs1 PE=2 SV=1
9	AFDB:Q54869	0.863	0.885	7.942E-43	563	0.330	0.339	Q54869.pdb.gz	SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=argS PE=1 SV=2
10	AFDB:Q8SXK2	0.842	0.821	5.978E-37	594	0.349	0.340	Q8SXK2.pdb.gz	Q8SXK2_DROME arginine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ArgRS-m PE=2 SV=1
11	AFDB:O23247	0.855	0.775	1.405E-35	642	0.304	0.274	O23247.pdb.gz	SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1027 PE=1 SV=1
12	PDB:5yymA	0.842	0.837	3.934E-32	581	0.272	0.270	5yymA.pdb.gz	Crystal Structures Of E.Coli Arginyl-Trna Synthetase (Argrs) In Complex With Substrates
13	PDB:4r3zB	0.826	0.732	1.012E-30	659	0.275	0.241	4r3zB.pdb.gz
14	PDB:5b63C	0.792	0.826	1.054E-28	553	0.263	0.275	5b63C.pdb.gz	Crystal structures of E.coli arginyl-tRNA synthetase (ArgRS) in complex with substrate tRNA(Arg)
15	PDB:1li7B	0.437	0.637	1.512E-8	375	0.100	0.155	1li7B.pdb.gz	Structural origins of amino acid selection without editing by cysteinyl-tRNA synthetase
16	PDB:1u0bB	0.425	0.516	1.052E-7	461	0.107	0.134	1u0bB.pdb.gz	Shape-selective RNA recognition by cysteinyl-tRNA synthetase
17	PDB:6ax8A	0.481	0.539	1.050E-6	509	0.119	0.136	6ax8A.pdb.gz	The crystal structure of the drug target Mycobacterium tuberculosis methionyl-tRNA synthetase in complex with a catalytic intermediate.
18	PDB:2ja2A	0.281	0.329	2.818E-4	485	0.111	0.132	2ja2A.pdb.gz
19	PDB:4a91A	0.264	0.496	7.267E-4	290	0.059	0.117	4a91A.pdb.gz	Crystal Structure of Glutamyl-Queuosine Trnaasp Synthetase Complexed with L-Glutamate: Structural Elements Mediating tRNA-Independent Activation of Glutamate and Glutamylation of Trnaasp Anticodon.
20	PDB:2hz7A	0.268	0.278	6.931E-3	556	0.083	0.086	2hz7A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U186	0.0	1055	578	0.865	0.865	SYRM_MOUSE Probable arginine--tRNA ligase, mitochondrial OS=Mus musculus OX=10090 GN=Rars2 PE=1 SV=1
2	Q5T160	0.0	1197	578	1.000	1.000	SYRM_HUMAN Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1
3	Q6PGW8	0.0	662	597	0.571	0.553	Q6PGW8_DANRE arginine--tRNA ligase OS=Danio rerio OX=7955 GN=zgc:63702 PE=1 SV=1
4	Q558Z0	2.84e-144	431	589	0.407	0.399	SYRC_DICDI Probable arginine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=argS1 PE=3 SV=1
5	Q05506	3.17e-141	424	607	0.382	0.364	SYRC_YEAST Arginine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR341C PE=1 SV=1
6	P38714	8.88e-137	414	643	0.381	0.342	SYRM_YEAST Arginine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MSR1 PE=3 SV=3
7	O74781	8.37e-125	382	618	0.400	0.374	SYRC_SCHPO Probable arginine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mrs1 PE=2 SV=1
8	Q54869	2.81e-105	330	563	0.343	0.352	SYR_STRPN Arginine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=argS PE=1 SV=2
9	Q8SXK2	1.01e-96	308	594	0.324	0.315	Q8SXK2_DROME arginine--tRNA ligase OS=Drosophila melanogaster OX=7227 GN=ArgRS-m PE=2 SV=1
10	O23247	1.27e-68	236	642	0.299	0.269	SYRM_ARATH Arginine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=EMB1027 PE=1 SV=1
11	Q9C713	1.59e-63	221	590	0.291	0.285	SYRC_ARATH Arginine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana OX=3702 GN=At1g66530 PE=1 SV=1
12	Q9VXN4	2.14e-61	216	665	0.265	0.230	SYRC_DROME Probable arginine--tRNA ligase, cytoplasmic OS=Drosophila melanogaster OX=7227 GN=ArgRS PE=2 SV=1
13	P40329	1.89e-59	211	660	0.270	0.236	SYRC_RAT Arginine--tRNA ligase, cytoplasmic OS=Rattus norvegicus OX=10116 GN=Rars1 PE=1 SV=2
14	Q9D0I9	1.22e-58	209	660	0.268	0.235	SYRC_MOUSE Arginine--tRNA ligase, cytoplasmic OS=Mus musculus OX=10090 GN=Rars1 PE=1 SV=2
15	P54136	1.77e-56	203	660	0.270	0.236	SYRC_HUMAN Arginine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=RARS1 PE=1 SV=2
16	P11875	2.60e-55	198	577	0.272	0.272	SYR_ECOLI Arginine--tRNA ligase OS=Escherichia coli (strain K12) OX=83333 GN=argS PE=1 SV=1
17	Q19825	8.14e-53	194	713	0.260	0.210	SYRC_CAEEL Probable arginine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans OX=6239 GN=rars-1 PE=3 SV=2
18	O51540	2.16e-48	179	585	0.235	0.232	SYR_BORBU Arginine--tRNA ligase OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=argS PE=3 SV=2
19	Q386W0	1.41e-27	120	692	0.175	0.146	Q386W0_TRYB2 arginine--tRNA ligase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.46.0008 PE=3 SV=1
20	P9WFW5	1.80e-15	81.6	550	0.220	0.231	SYR_MYCTU Arginine--tRNA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=argS PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05746 DALR_1	1.5e-17	75.2	DALR anticodon binding domain
2	PF09190 DALR_2	6.9e+02	12.2	DALR domain
3	PF00750 tRNA-synt_1d	3.7e-92	320.6	tRNA synthetases class I (R)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358549

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000307567	0.977	Glutamine--tRNA ligase
2	9606.ENSP00000355890	0.964	Bifunctional glutamate/proline--tRNA ligase
3	9606.ENSP00000362576	0.955	Tyrosine--tRNA ligase, cytoplasmic
4	9606.ENSP00000472847	0.952	Serine--tRNA ligase, mitochondrial
5	9606.ENSP00000395196	0.943	Probable glutamate--tRNA ligase, mitochondrial
6	9606.ENSP00000408576	0.943	Probable leucine--tRNA ligase, mitochondrial
7	9606.ENSP00000320658	0.942	Tyrosine--tRNA ligase, mitochondrial
8	9606.ENSP00000377954	0.938	Leucine--tRNA ligase, cytoplasmic
9	9606.ENSP00000364794	0.927	Isoleucine--tRNA ligase, cytoplasmic
10	9606.ENSP00000282276	0.923	Methionine--tRNA ligase, mitochondrial
11	9606.ENSP00000378191	0.921	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1
12	9606.ENSP00000262027	0.917	Methionine--tRNA ligase, cytoplasmic
13	9606.ENSP00000355889	0.916	Isoleucine--tRNA ligase, mitochondrial
14	9606.ENSP00000355086	0.915	Aspartate--tRNA ligase, mitochondrial
15	9606.ENSP00000234677	0.912	Serine--tRNA ligase, cytoplasmic
16	9606.ENSP00000281038	0.910	Probable asparagine--tRNA ligase, mitochondrial
17	9606.ENSP00000325448	0.902	Lysine--tRNA ligase
18	9606.ENSP00000360327	0.897	Probable proline--tRNA ligase, mitochondrial
19	9606.ENSP00000316335	0.893	Phenylalanine--tRNA ligase, mitochondrial
20	9606.ENSP00000257347	0.892	Probable cysteine--tRNA ligase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004814	1.000	arginine-tRNA ligase activity
GO:0003723	0.997	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1901564	0.996	organonitrogen compound metabolic process
GO:0010467	0.996	gene expression
GO:0019752	0.995	carboxylic acid metabolic process
GO:0090304	0.995	nucleic acid metabolic process
GO:0006412	0.990	translation
GO:0043039	0.989	tRNA aminoacylation
GO:0006418	0.963	tRNA aminoacylation for protein translation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.998	intracellular organelle lumen
GO:0005759	0.888	mitochondrial matrix
GO:0005634	0.699	nucleus
GO:0031981	0.417	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:20301	1.000	ATP + L-arginine + tRNA(Arg) = AMP + diphosphate + L-arginyl-tRNA(Arg)
EC:6.1.1.19	1.000	arginine--tRNA ligase.

[back to server]