StarFunc result for job id Q5T197

User Input

>input (706 residues)
MDIKHHQNGTRGQRRKQPHTTVQRLLTWGLPVSCSWFLWRQPGEFPVTALLLGAGAGGLL
AIGLFQLLVNPMNIYEEQKIMFLYSLVGLGAMGWGTSPHIRCASLLLVPKMLGKEGRLFV
LGYALAAIYVGPVANLRHNLNNVIASLGCTVELQINNTRAAWRISTAPLRAMFKDLLSSK
ELLRAETRNISATFEDLDAQVNSETGYTPEDTMDSGETAQGREARQAPASRLHLSTQKMY
ELKTKLRCSYVVNQAILSCRRWFDRKHEQCMKHIWVPLLTHLLCLPMKFKFFCGIAKVME
VWCRNRIPVEGNFGQTYDSLNQSIRGLDGEFSANIDFKEEKQAGVLGLNTSWERVSTEVR
DYVYRQEARLEWALGLLHVLLSCTFLLVLHASFSYMDSYNHDIRFDNIYISTYFCQIDDR
RKKLGKRTLLPLRKAEEKTVIFPCKPTIQASEMSNVVRELLETLPILLLLVVLCGLDWAL
YSIFDTIRHHSFLQYSFRSSHKLEVKVGGDSMLARLLRKTIGALNTSSETVMESNNMPCL
PQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLK
KRAAFTKLRRAAILRRERQQKAPRHPLADILHRGCPLLRRWLCRRCVVCQAPETPESYVC
RTLDCEAVYCWSCWDDMRQRCPVCTPREELSSSAFSDSNDDTAYAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T197	1.000	1.000	4.847E-98	706	1.000	1.000	Q5T197.pdb.gz	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1
2	AFDB:Q059Y8	0.751	0.727	6.791E-74	732	0.714	0.689	Q059Y8.pdb.gz	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
3	AFDB:F8W407	0.806	0.840	3.755E-50	675	0.387	0.404	F8W407.pdb.gz
4	AFDB:Q9VU52	0.697	0.689	6.033E-32	715	0.237	0.234	Q9VU52.pdb.gz	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3
5	AFDB:A0A140LIJ0	0.594	0.598	8.560E-26	701	0.205	0.207	A0A140LIJ0.pdb.gz	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
6	AFDB:Q17461	0.440	0.407	1.211E-15	774	0.161	0.147	Q17461.pdb.gz	Q17461_CAEEL Dendritic cell-specific transmembrane protein-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spe-42 PE=4 SV=5
7	AFDB:Q7TNJ0	0.441	0.639	3.658E-13	470	0.142	0.213	Q7TNJ0.pdb.gz	DCSTP_MOUSE Dendritic cell-specific transmembrane protein OS=Mus musculus OX=10090 GN=Dcstamp PE=1 SV=1
8	AFDB:Q9H295	0.458	0.664	9.266E-13	470	0.153	0.230	Q9H295.pdb.gz	DCSTP_HUMAN Dendritic cell-specific transmembrane protein OS=Homo sapiens OX=9606 GN=DCSTAMP PE=1 SV=1
9	AFDB:Q9D611	0.376	0.512	2.056E-12	498	0.136	0.193	Q9D611.pdb.gz	OCSTP_MOUSE Osteoclast stimulatory transmembrane protein OS=Mus musculus OX=10090 GN=Ocstamp PE=1 SV=1
10	AFDB:D3ZVC2	0.266	0.495	1.150E-4	344	0.089	0.183	D3ZVC2.pdb.gz	D3ZVC2_RAT Dendrocyte expressed seven transmembrane protein OS=Rattus norvegicus OX=10116 GN=Dcstamp PE=4 SV=3
11	PDB:7rroA1	0.102	0.161	1.760E-1	396	0.086	0.154	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
12	PDB:5ykeB	0.070	0.061	1.840E-1	845	0.105	0.088	5ykeB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
13	PDB:7ungA1	0.080	0.128	2.864E-1	391	0.074	0.133	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
14	PDB:6j8gA	0.074	0.052	3.736E-1	1140	0.122	0.075	6j8gA.pdb.gz	Structures of human Nav1.7 channel in complex with auxiliary subunits and animal toxins.
15	PDB:7rroD1	0.090	0.134	5.816E-1	425	0.081	0.134	7rroD1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:7p5jA	0.065	0.099	6.079E-1	399	0.081	0.143	7p5jA.pdb.gz
17	PDB:5w81A	0.073	0.048	7.256E-1	1173	0.076	0.046	5w81A.pdb.gz	Conformational Changes of CFTR upon Phosphorylation and ATP Binding.
18	PDB:6x15A	0.072	0.107	7.256E-1	419	0.076	0.129	6x15A.pdb.gz	Large domain movements through the lipid bilayer mediate substrate release and inhibition of glutamate transporters.
19	PDB:6msmA	0.078	0.050	9.054E-1	1181	0.075	0.045	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:7rroF1	0.094	0.134	9.892E-1	421	0.061	0.102	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q059Y8	0.0	1026	732	0.717	0.691	DCST1_MOUSE E3 ubiquitin-protein ligase DCST1 OS=Mus musculus OX=10090 GN=Dcst1 PE=1 SV=1
2	Q5T197	0.0	1465	706	1.000	1.000	DCST1_HUMAN E3 ubiquitin-protein ligase DCST1 OS=Homo sapiens OX=9606 GN=DCST1 PE=1 SV=1
3	Q9VU52	1.77e-45	175	715	0.221	0.218	SNKY_DROME Protein sneaky OS=Drosophila melanogaster OX=7227 GN=snky PE=2 SV=3
4	A0A140LIJ0	3.69e-32	135	701	0.207	0.208	DCST2_MOUSE DC-STAMP domain-containing protein 2 OS=Mus musculus OX=10090 GN=Dcst2 PE=1 SV=1
5	Q17461	4.52e-13	75.1	774	0.089	0.081	Q17461_CAEEL Dendritic cell-specific transmembrane protein-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=spe-42 PE=4 SV=5
6	Q9H295	6.96e-09	61.2	470	0.085	0.128	DCSTP_HUMAN Dendritic cell-specific transmembrane protein OS=Homo sapiens OX=9606 GN=DCSTAMP PE=1 SV=1
7	Q7TNJ0	5.13e-06	52.0	470	0.067	0.100	DCSTP_MOUSE Dendritic cell-specific transmembrane protein OS=Mus musculus OX=10090 GN=Dcstamp PE=1 SV=1
8	Q9D611	8.72e-04	45.1	498	0.055	0.078	OCSTP_MOUSE Osteoclast stimulatory transmembrane protein OS=Mus musculus OX=10090 GN=Ocstamp PE=1 SV=1
9	D3ZVC2	0.001	44.7	470	0.065	0.098	D3ZVC2_RAT Dendrocyte expressed seven transmembrane protein OS=Rattus norvegicus OX=10116 GN=Dcstamp PE=4 SV=3
10	Q9W0D7	0.19	37.0	299	0.072	0.171	Q9W0D7_DROME GM14467p OS=Drosophila melanogaster OX=7227 GN=Pex10 PE=2 SV=1
11	Q8IHC3	0.74	35.4	617	0.028	0.032	Q8IHC3_DROME AT14906p OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
12	Q8IHE0	0.74	35.4	582	0.028	0.034	Q8IHE0_DROME AT10134p (Fragment) OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
13	Q4TU90	0.81	34.7	215	0.047	0.153	Q4TU90_MOUSE Reproductive homeobox 3A OS=Mus musculus OX=10090 GN=Rhox3a2 PE=2 SV=1
14	Q8IMZ2	0.91	35.0	559	0.028	0.036	Q8IMZ2_DROME Oo18 RNA-binding protein, isoform C OS=Drosophila melanogaster OX=7227 GN=orb PE=4 SV=1
15	Q8IMZ3	1.2	35.0	913	0.028	0.022	Q8IMZ3_DROME Oo18 RNA-binding protein, isoform B OS=Drosophila melanogaster OX=7227 GN=orb PE=4 SV=1
16	Q9VCN7	1.2	35.0	915	0.028	0.022	Q9VCN7_DROME FI20148p1 OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
17	Q24433	1.3	35.0	915	0.028	0.022	Q24433_DROME Ovarian protein OS=Drosophila melanogaster OX=7227 GN=orb PE=2 SV=1
18	Q6NCB2	3.1	33.5	476	0.035	0.053	Q6NCB2_RHOPA Malonyl-CoA decarboxylase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) OX=258594 GN=MLYCD/MCD PE=1 SV=1
19	Q57ZG6	4.0	33.1	906	0.020	0.015	Q57ZG6_TRYB2 Lanosterol synthase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.490 PE=4 SV=1
20	Q9WTZ1	6.1	30.8	113	0.023	0.142	RBX2_MOUSE RING-box protein 2 OS=Mus musculus OX=10090 GN=Rnf7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07782 DC_STAMP	3.7e-51	185.1	DC-STAMP-like protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000295542

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000431871	0.564	Nuclear pore complex interacting protein family member B6
2	9606.ENSP00000303424	0.547	Prostaglandin D2 receptor
3	9606.ENSP00000468767	0.507	Tartrate-resistant acid phosphatase type 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0019538	0.986	protein metabolic process
GO:0009966	0.975	regulation of signal transduction
GO:0006508	0.972	proteolysis
GO:0080134	0.933	regulation of response to stress
GO:0009968	0.919	negative regulation of signal transduction
GO:0060759	0.909	regulation of response to cytokine stimulus
GO:0031348	0.905	negative regulation of defense response
GO:0009057	0.903	macromolecule catabolic process
GO:0002832	0.903	negative regulation of response to biotic stimulus
GO:0060761	0.897	negative regulation of response to cytokine stimulus
GO:0050776	0.864	regulation of immune response
GO:0043632	0.845	modification-dependent macromolecule catabolic process
GO:0032101	0.844	regulation of response to external stimulus
GO:0030163	0.844	protein catabolic process
GO:0019941	0.809	modification-dependent protein catabolic process
GO:0001959	0.801	regulation of cytokine-mediated signaling pathway
GO:0045824	0.789	negative regulation of innate immune response
GO:0060338	0.772	regulation of type I interferon-mediated signaling pathway
GO:0001960	0.772	negative regulation of cytokine-mediated signaling pathway
GO:0006511	0.740	ubiquitin-dependent protein catabolic process
GO:0050896	0.381	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.935	intracellular anatomical structure
GO:0043226	0.933	organelle
GO:0043231	0.914	intracellular membrane-bounded organelle
GO:0005737	0.760	cytoplasm
GO:0005829	0.678	cytosol
GO:0005634	0.421	nucleus
GO:0031981	0.340	nuclear lumen
GO:0005654	0.309	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]