StarFunc result for job id Q5T1B0

User Input

>input (1012 residues)
MSLPKTPSTPLNSTSTSESKKLKVSVAKEGTRGLPELKEKKNMVDRSKLLPTSLQNEFIP
KEVLLSLTYAANAGPCPENLLPPKKIKTPKGTLPRLVDHVWHHPVRRNKFKYLIDHPVSL
TGAGRDISFLYDVTYAKGQTREKAVCPPHLARSLQSHDGVIVPHKPKTLTDTLIPEEFHI
VSSTGVSGLECYDDKYTTLLTDSENRLLLFPSMKPNKRVEVAQLNDVMDTMLERAGVENQ
EYTGPTKMHKLLHILKKEQTIYNMIFHELIRQVSVDCADRGELLSKVRERYVQMLDQIAR
QMIDFYKDLVTQRVMDQRILEELYNFKHVIEELTRELCLVRAHDVKLTKETEKAHKDLAQ
ALLNAEKNAKIVEEYHDLYTLQRERMENDMKKLVAERDIWSSATYELALKVIERNRVILA
RRLYLNEKGWNKYTKHFIILLSNKDTEDLALLQKLTQKWRNLVNKLKQEVEQMEESTSET
LKIVKDGLIKWQEFFNEKDILSPNKGNIFNSVLLDFKQWQKILNEKKEEFTGDVLLSKYD
TLKIIKHLQENWADIGLGIFNRHKSLEGEMPSERQYMEEIIKNIQKLYKEYEIRINGDNG
YSKILPSLISSLDFCSFKLENLEFPDTPLEEWQEIDEKINEMKSHLDILLNLTGIVPQHI
DVDSVSVLQAYIFNMIQQWLLKIGNEINNGNIELQHHMDELHISMIQWMVNLLILMIPNF
TDQDCLLKLEEESAEKHDIGVARLELDAIELTRKLYQYSSYLSSCCKGMVTAMALSKSTN
SHKNATEDLYEVDKLKKECYEWINTCSCLLSNIKGRKITLLTYEEIERLLEEEAVKEFIE
PEIDESFKEDEEESKEDRKLQEENKERAEEQPSTSTEKEKLIRFIGEDENVHSKPLFETD
VLSSWRESAKQGTLAQKYLEAMAVIEHMQEKLLEVENRARQAEEKFEDAYEKLHHTLIKN
KDLEELVMTSRKESKEEKENQDEREVKEEEEQQEEEEVRSAENSSKSPKKGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q55FW7	0.065	0.077	1.013E-6	837	0.102	0.123	Q55FW7.pdb.gz	GLE1_DICDI mRNA export factor GLE1 OS=Dictyostelium discoideum OX=44689 GN=gle1 PE=3 SV=1
2	AFDB:P33338	0.088	0.092	2.045E-5	968	0.106	0.111	P33338.pdb.gz	SLA2_YEAST Protein SLA2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SLA2 PE=1 SV=5
3	AFDB:O08788	0.078	0.064	5.658E-5	1281	0.136	0.108	O08788.pdb.gz	DCTN1_MOUSE Dynactin subunit 1 OS=Mus musculus OX=10090 GN=Dctn1 PE=1 SV=3
4	AFDB:Q12411	0.119	0.188	5.939E-5	609	0.083	0.138	Q12411.pdb.gz	MPC70_YEAST Sporulation-specific protein 21 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPO21 PE=1 SV=1
5	AFDB:Q38CI3	0.090	0.062	1.354E-4	1685	0.117	0.070	Q38CI3.pdb.gz	Q38CI3_TRYB2 Exocyst complex component Sec8 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7690 PE=3 SV=1
6	AFDB:F1P0K1	0.103	0.105	3.400E-4	997	0.165	0.168	F1P0K1.pdb.gz
7	AFDB:Q9ASV5	0.093	0.130	9.410E-4	650	0.096	0.149	Q9ASV5.pdb.gz	MIC60_ARATH MICOS complex subunit MIC60, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=MIC60 PE=1 SV=1
8	AFDB:Q386C3	0.074	0.069	1.456E-3	1108	0.141	0.129	Q386C3.pdb.gz	Q386C3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1410 PE=4 SV=1
9	AFDB:Q6P2H3	0.085	0.111	1.947E-3	762	0.111	0.147	Q6P2H3.pdb.gz	CEP85_HUMAN Centrosomal protein of 85 kDa OS=Homo sapiens OX=9606 GN=CEP85 PE=1 SV=1
10	AFDB:Q960Y8	0.078	0.086	3.656E-3	874	0.122	0.141	Q960Y8.pdb.gz	Q960Y8_DROME Aluminum tubes, isoform G OS=Drosophila melanogaster OX=7227 GN=alt PE=1 SV=1
11	PDB:6ob7A	0.057	0.116	2.951E-2	381	0.042	0.110	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
12	PDB:5y50A	0.059	0.111	3.760E-2	448	0.040	0.089	5y50A.pdb.gz
13	PDB:7rroA1	0.072	0.144	8.572E-2	396	0.060	0.154	7rroA1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
14	PDB:7ungA1	0.077	0.164	8.572E-2	391	0.067	0.174	7ungA1.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
15	PDB:7rroF1	0.073	0.151	8.997E-2	421	0.051	0.124	7rroF1.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:1qoyA	0.095	0.268	1.263E-1	303	0.041	0.135	1qoyA.pdb.gz
17	PDB:7ogtB	0.076	0.099	2.153E-1	708	0.096	0.137	7ogtB.pdb.gz
18	PDB:3jcmI	0.075	0.153	2.372E-1	416	0.049	0.120	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
19	PDB:5lkiA	0.076	0.056	2.743E-1	1427	0.030	0.021	5lkiA.pdb.gz
20	PDB:6yvuB	0.076	0.066	2.879E-1	1191	0.098	0.083	6yvuB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q385L7	5.87e-05	48.1	235	0.032	0.136	Q385L7_TRYB2 Dynein arm light chain, axonemal, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.3200 PE=4 SV=1
2	Q6GN86	0.002	43.1	254	0.026	0.102	IDLC_XENLA Axonemal dynein light intermediate polypeptide 1 OS=Xenopus laevis OX=8355 GN=dnali1 PE=2 SV=1
3	Q39604	0.005	42.4	253	0.024	0.095	IDLC_CHLRE 28 kDa inner dynein arm light chain, axonemal OS=Chlamydomonas reinhardtii OX=3055 GN=IDA4 PE=1 SV=1
4	O14645	0.006	42.0	258	0.025	0.097	IDLC_HUMAN Axonemal dynein light intermediate polypeptide 1 OS=Homo sapiens OX=9606 GN=DNALI1 PE=1 SV=2
5	Q8BVN8	0.006	42.0	258	0.025	0.097	IDLC_MOUSE Axonemal dynein light intermediate polypeptide 1 OS=Mus musculus OX=10090 GN=Dnali1 PE=1 SV=1
6	Q80VJ8	0.98	35.8	648	0.069	0.108	KASH5_MOUSE Protein KASH5 OS=Mus musculus OX=10090 GN=Kash5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10211 Ax_dynein_light	3e-05	35.5	Axonemal dynein light chain
2	PF09504 RE_Bsp6I	1.2e+02	13.8	Bsp6I restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356590

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358820	0.771	Epidermal growth factor receptor kinase substrate 8-like protein 3
2	9606.ENSP00000368511	0.745	Putative uncharacterized protein CXorf58
3	9606.ENSP00000427562	0.712	Abelson tyrosine-protein kinase 2
4	9606.ENSP00000323847	0.695	ADP-ribosylation factor-like protein 14
5	9606.ENSP00000417035	0.685	Putative uncharacterized protein C19orf81
6	9606.ENSP00000335017	0.629	Proline-rich protein 30
7	9606.ENSP00000352904	0.528	Cytosolic 5'-nucleotidase 1B
8	9606.ENSP00000368872	0.513	Protein inscuteable homolog
9	9606.ENSP00000357575	0.504	Cilia- and flagella-associated protein 46
10	9606.ENSP00000436042	0.503	Protocadherin alpha-9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0006996	0.907	organelle organization
GO:0007017	0.892	microtubule-based process
GO:0003341	0.829	cilium movement
GO:0000003	0.554	reproduction
GO:0022414	0.536	reproductive process
GO:0044085	0.483	cellular component biogenesis
GO:0032502	0.392	developmental process
GO:0032501	0.364	multicellular organismal process
GO:0022607	0.344	cellular component assembly
GO:0019953	0.329	sexual reproduction
GO:0007010	0.315	cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0043227	0.994	membrane-bounded organelle
GO:0043232	0.959	intracellular non-membrane-bounded organelle
GO:0043231	0.940	intracellular membrane-bounded organelle
GO:0005829	0.934	cytosol
GO:0005856	0.620	cytoskeleton
GO:0031982	0.387	vesicle
GO:0120025	0.339	plasma membrane bounded cell projection
GO:0005929	0.332	cilium
GO:0005634	0.313	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]