StarFunc result for job id Q5T1H1

User Input

>input (1400 residues)
MTDKSIVILSLMVFHSSFINGKTCRRQLVEEWHPQPSSYVVNWTLTENICLDFYRDCWFL
GVNTKIDTSGNQAVPQICPLQIQLGDILVISSEPSLQFPEINLMNVSETSFVGCVQNTTT
EDQLLFGCRLKGMHTVNSKWLSVGTHYFITVMASGPSPCPLGLRLNVTVKQQFCQESLSS
EFCSGHGKCLSEAWSKTYSCHCQPPFSGKYCQELDACSFKPCKNNGSCINKRENWDEQAY
ECVCHPPFTGKNCSEIIGQCQPHVCFHGNCSNITSNSFICECDEQFSGPFCEVSAKPCVS
LLFWKRGICPNSSSAYTYECPKGSSSQNGETDVSEFSLVPCQNGTDCIKISNDVMCICSP
IFTDLLCKSIQTSCESFPLRNNATCKKCEKDYPCSCISGFTEKNCEKAIDHCKLLSINCL
NEEWCFNIIGRFKYVCIPGCTKNPCWFLKNVYLIHQHLCYCGVTFHGICQDKGPAQFEYV
WQLGFAGSEGEKCQGVIDAYFFLAANCTEDATYVNDPEDNNSSCWFPHEGTKEICANGCS
CLSEEDSQEYRYLCFLRWAGNMYLENTTDDQENECQHEAVCKDEINRPRCSCSLSYIGRL
CVVNVDYCLGNHSISVHGLCLALSHNCNCSGLQRYERNICEIDTEDCKSASCKNGTTSTH
LRGYFFRKCVPGFKGTQCEIDIDECASHPCKNGATCIDQPGNYFCQCVPPFKVVDGFSCL
CNPGYVGIRCEQDIDDCILNACEHNSTCKDLHLSYQCVCLSDWEGNFCEQESNECKMNPC
KNNSTCTDLYKSYRCECTSGWTGQNCSEEINECDSDPCMNGGLCHESTIPGQFVCLCPPL
YTGQFCHQRYNLCDLLHNPCRNNSTCLALVDANQHCICREEFEGKNCEIDVKDCLFLSCQ
DYGDCEDMVNNFRCICRPGFSGSLCEIEINECSSEPCKNNGTCVDLTNRFFCNCEPEYHG
PFCELDVNKCKISPCLDEENCVYRTDGYNCLCAPGYTGINCEINLDECLSEPCLHDGVCI
DGINHYTCDCKSGFFGTHCETNANDCLSNPCLHGRCTELINEYPCSCDADGTSTQCKIKI
NDCTSIPCMNEGFCQKSAHGFTCICPRGYTGAYCEKSIDNCAEPELNSVICLNGGICVDG
PGHTFDCRCLPGFSGQFCEININECSSSPCLHGADCEDHINGYVCKCQPGWSGHHCENEL
ECIPNSCVHELCMENEPGSTCLCTPGFMTCSIGLLCGDEIRRITCLTPIFQRTDPISTQT
YTIPPSETLVSSFPSIKATRIPAIMDTYPVDQGPKQTGIVKHDILPTTGLATLRISTPLE
SYLLQELIVTRELSAKHSLLSSADVSSSRFLNFGIRDPAQIVQDKTSVSHMPIRTSAATL
GFFFPDRRARTPFIMSSLMS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:7q3nU	0.050	0.181	4.384E-5	292	0.027	0.130	7q3nU.pdb.gz	Structure of the decoy module of human glycoprotein 2 and uromodulin and its interaction with bacterial adhesin FimH.
2	AFDB:Q6R8J2	0.048	0.067	3.466E-4	977	0.077	0.111	Q6R8J2.pdb.gz	HEG_DANRE Protein HEG OS=Danio rerio OX=7955 GN=heg PE=1 SV=1
3	PDB:4g1eB	0.043	0.072	2.214E-3	709	0.031	0.061	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
4	PDB:5es4B	0.042	0.071	2.619E-3	674	0.022	0.046	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
5	AFDB:A0A2R8QK78	0.040	0.036	1.057E-2	1570	0.079	0.070	A0A2R8QK78.pdb.gz
6	PDB:7nycC	0.039	0.059	1.406E-2	809	0.029	0.051	7nycC.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
7	AFDB:Q9ULI3	0.057	0.058	1.565E-2	1381	0.114	0.116	Q9ULI3.pdb.gz	HEG1_HUMAN Protein HEG homolog 1 OS=Homo sapiens OX=9606 GN=HEG1 PE=1 SV=3
8	AFDB:Q0KIB0	0.039	0.032	3.835E-2	1689	0.117	0.097	Q0KIB0.pdb.gz	Q0KIB0_DROME Sidestep III, isoform O OS=Drosophila melanogaster OX=7227 GN=side-III PE=1 SV=1
9	PDB:5f1aA	0.031	0.074	4.078E-2	553	0.013	0.033	5f1aA.pdb.gz	Crystal Structure of Aspirin-Acetylated Human Cyclooxygenase-2: Insight into the Formation of Products with Reversed Stereochemistry.
10	PDB:2bo0A	0.057	0.202	5.102E-2	336	0.014	0.057	2bo0A.pdb.gz	High Resolution Structural Studies of Mutants Provide Insights Into Catalysis and Electron Transfer Processes in Copper Nitrite Reductase
11	PDB:2aanA	0.052	0.418	6.384E-2	123	0.008	0.089	2aanA.pdb.gz	The Crystal Structure of Auracyanin A at 1.85 A Resolution: Why the Photosynthetic Bacterium Chloroflexus Needs Two Almost Identical 'Blue' Copper Proteins
12	PDB:3qqxA	0.045	0.120	6.752E-2	474	0.011	0.032	3qqxA.pdb.gz	CueO E506D Mutant: Crystal Structure of Reduced Native Intermediate, Kinetics, and Impairment of Product Release
13	PDB:4rs0A	0.028	0.069	6.752E-2	557	0.011	0.029	4rs0A.pdb.gz	Action at a Distance: MUTATIONS OF PERIPHERAL RESIDUES TRANSFORM RAPID REVERSIBLE INHIBITORS TO SLOW, TIGHT BINDERS OF CYCLOOXYGENASE-2.
14	AFDB:P13608	0.035	0.025	7.102E-2	2364	0.104	0.062	P13608.pdb.gz	PGCA_BOVIN Aggrecan core protein OS=Bos taurus OX=9913 GN=ACAN PE=1 SV=3
15	PDB:2dv6A	0.056	0.160	7.553E-2	422	0.010	0.033	2dv6A.pdb.gz	Structure and function of a hexameric copper-containing nitrite reductase.
16	AFDB:O88783	0.043	0.029	1.112E-1	2183	0.106	0.068	O88783.pdb.gz	FA5_MOUSE Coagulation factor V OS=Mus musculus OX=10090 GN=F5 PE=1 SV=1
17	AFDB:Q54PV1	0.022	0.021	4.266E-1	1800	0.101	0.079	Q54PV1.pdb.gz	Q54PV1_DICDI Inositol 5-phosphatase OS=Dictyostelium discoideum OX=44689 GN=Dd5P2 PE=4 SV=1
18	AFDB:Q9W283	0.029	0.030	7.064E-1	1329	0.106	0.112	Q9W283.pdb.gz	Q9W283_DROME Arc, isoform A OS=Drosophila melanogaster OX=7227 GN=a PE=2 SV=2
19	AFDB:Q8IRB5	0.039	0.038	7.471E-1	1465	0.119	0.114	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
20	AFDB:Q6FPN0	0.034	0.047	7.901E-1	870	0.064	0.103	Q6FPN0.pdb.gz	AWP1_CANGA Adhesin AWP1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=AWP1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B8JI71	0.0	676	2904	0.320	0.154	EYS_DANRE Protein eyes shut homolog OS=Danio rerio OX=7955 GN=eys PE=1 SV=2
2	Q5T1H1	0.0	2912	3165	1.000	0.442	EYS_HUMAN Protein eyes shut homolog OS=Homo sapiens OX=9606 GN=EYS PE=1 SV=5
3	P46531	1.61e-147	500	2555	0.259	0.142	NOTC1_HUMAN Neurogenic locus notch homolog protein 1 OS=Homo sapiens OX=9606 GN=NOTCH1 PE=1 SV=4
4	Q800E4	6.52e-146	495	2468	0.256	0.145	Q800E4_DANRE Neurogenic locus notch homolog protein 3 precursor OS=Danio rerio OX=7955 GN=fa14b08 PE=1 SV=1
5	Q01705	1.01e-142	486	2531	0.244	0.135	NOTC1_MOUSE Neurogenic locus notch homolog protein 1 OS=Mus musculus OX=10090 GN=Notch1 PE=1 SV=3
6	P07207	2.30e-142	485	2703	0.253	0.131	NOTCH_DROME Neurogenic locus Notch protein OS=Drosophila melanogaster OX=7227 GN=N PE=1 SV=3
7	G3I6Z6	1.30e-141	483	2527	0.244	0.135	NOTC1_CRIGR Neurogenic locus notch homolog protein 1 OS=Cricetulus griseus OX=10029 GN=NOTCH1 PE=1 SV=2
8	Q07008	1.50e-141	483	2531	0.244	0.135	NOTC1_RAT Neurogenic locus notch homolog protein 1 OS=Rattus norvegicus OX=10116 GN=Notch1 PE=1 SV=3
9	A2RUV0	1.83e-140	479	2522	0.245	0.136	NOTC1_XENTR Neurogenic locus notch homolog protein 1 OS=Xenopus tropicalis OX=8364 GN=notch1 PE=1 SV=2
10	O35516	2.56e-140	479	2473	0.251	0.142	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
11	P21783	2.13e-139	476	2524	0.245	0.136	NOTC1_XENLA Neurogenic locus notch homolog protein 1 OS=Xenopus laevis OX=8355 GN=notch1 PE=1 SV=3
12	Q9QW30	4.26e-139	475	2471	0.249	0.141	NOTC2_RAT Neurogenic locus notch homolog protein 2 OS=Rattus norvegicus OX=10116 GN=Notch2 PE=1 SV=1
13	P46530	6.02e-138	472	2437	0.246	0.142	NOTC1_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=notch1a PE=2 SV=1
14	F1RCH4	7.52e-138	471	2475	0.259	0.147	F1RCH4_DANRE Neurogenic locus notch homolog protein 2 precursor OS=Danio rerio OX=7955 GN=notch6 PE=3 SV=1
15	A0PGH6	5.02e-135	463	2465	0.256	0.145	A0PGH6_DANRE Neurogenic locus notch homolog protein 1 OS=Danio rerio OX=7955 GN=wu:fc55e11 PE=2 SV=1
16	Q04721	5.06e-135	463	2471	0.247	0.140	NOTC2_HUMAN Neurogenic locus notch homolog protein 2 OS=Homo sapiens OX=9606 GN=NOTCH2 PE=1 SV=3
17	Q61982	2.97e-126	436	2318	0.251	0.152	NOTC3_MOUSE Neurogenic locus notch homolog protein 3 OS=Mus musculus OX=10090 GN=Notch3 PE=1 SV=1
18	Q9UM47	2.14e-125	434	2321	0.251	0.151	NOTC3_HUMAN Neurogenic locus notch homolog protein 3 OS=Homo sapiens OX=9606 GN=NOTCH3 PE=1 SV=2
19	Q9R172	9.83e-124	429	2319	0.249	0.150	NOTC3_RAT Neurogenic locus notch homolog protein 3 OS=Rattus norvegicus OX=10116 GN=Notch3 PE=2 SV=2
20	P31695	1.36e-109	385	1964	0.227	0.162	NOTC4_MOUSE Neurogenic locus notch homolog protein 4 OS=Mus musculus OX=10090 GN=Notch4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00008 EGF	2.1e-64	224.6	EGF-like domain
2	PF07974 EGF_2	0.56	21.9	EGF-like domain
3	PF12947 EGF_3	62	15.2	EGF domain
4	PF07645 EGF_CA	0.52	21.9	Calcium-binding EGF domain
5	PF12661 hEGF	3.2e-38	140.3	Human growth factor-like EGF
6	PF06247 Plasmod_Pvs28	6.1	18.5	Pvs28 EGF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000424243

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000442600	0.799	Dystroglycan
2	9606.ENSP00000332809	0.710	Uncharacterized protein C2orf71
3	9606.ENSP00000324122	0.706	U4/U6 small nuclear ribonucleoprotein Prp31
4	9606.ENSP00000193391	0.705	Interphotoreceptor matrix proteoglycan 2
5	9606.ENSP00000359245	0.703	Retinal-specific ATP-binding cassette transporter
6	9606.ENSP00000341159	0.702	Ceramide kinase-like protein
7	9606.ENSP00000367766	0.689	X-linked retinitis pigmentosa GTPase regulator
8	9606.ENSP00000385158	0.681	Protein FAM161A
9	9606.ENSP00000229771	0.673	Tubby-related protein 1
10	9606.ENSP00000482504	0.671	Photoreceptor-specific nuclear receptor
11	9606.ENSP00000255266	0.668	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
12	9606.ENSP00000426809	0.668	Prominin-1
13	9606.ENSP00000251102	0.661	Cyclic nucleotide-gated cation channel beta-1
14	9606.ENSP00000465932	0.653	Progressive rod-cone degeneration protein
15	9606.ENSP00000262340	0.649	Retinoid isomerohydrolase
16	9606.ENSP00000363068	0.637	Protocadherin-15
17	9606.ENSP00000418438	0.634	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3
18	9606.ENSP00000331849	0.626	Mitochondrial ribosomal protein L54
19	9606.ENSP00000329158	0.622	Clarin-1
20	9606.ENSP00000449079	0.620	Retinol dehydrogenase 12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.967	multicellular organismal process
GO:0007601	0.940	visual perception
GO:0009584	0.866	detection of visible light
GO:0050908	0.845	detection of light stimulus involved in visual perception
GO:0048856	0.823	anatomical structure development
GO:0042246	0.792	tissue regeneration
GO:0043403	0.781	skeletal muscle tissue regeneration
GO:0009987	0.673	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0043227	0.979	membrane-bounded organelle
GO:0005576	0.876	extracellular region
GO:0031982	0.664	vesicle
GO:0005615	0.620	extracellular space
GO:1903561	0.617	extracellular vesicle
GO:0070062	0.614	extracellular exosome
GO:0016020	0.601	membrane
GO:0005886	0.431	plasma membrane
GO:0042995	0.379	cell projection
GO:0120025	0.354	plasma membrane bounded cell projection

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]