StarFunc result for job id Q5T1J5

User Input

>input (151 residues)
MPRGSRSRTSRMAPPASRAPQMRAAPRPAPVAQPPAAAPPSAVGSSAAAPRQPGLMAQMA
TTAAGVAVGSAVGHTQGHAVTGGFSGGSNAEPARPDIAYQEPQGTQPAQQQQPCFYGIKQ
FLECAQNQGDIKLCEDFSKVLKQCRLAKGLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9Y6H1	0.324	0.324	3.259E-16	151	0.940	0.940	Q9Y6H1.pdb.gz	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
2	AFDB:Q7TNL9	0.279	0.304	1.136E-8	138	0.536	0.587	Q7TNL9.pdb.gz	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
3	AFDB:Q9VX77	0.273	0.243	2.293E-8	170	0.490	0.435	Q9VX77.pdb.gz	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
4	AFDB:Q03667	0.371	0.361	3.556E-6	156	0.397	0.385	Q03667.pdb.gz	MIX17_YEAST Mitochondrial intermembrane space cysteine motif-containing protein MIX17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIX17 PE=1 SV=1
5	AFDB:Q14CN4	0.129	0.049	2.522	511	0.185	0.055	Q14CN4.pdb.gz	K2C72_HUMAN Keratin, type II cytoskeletal 72 OS=Homo sapiens OX=9606 GN=KRT72 PE=1 SV=2
6	AFDB:Q71F23	0.139	0.069	3.054	418	0.185	0.067	Q71F23.pdb.gz	CENPU_HUMAN Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU PE=1 SV=1
7	PDB:1ocrH	0.183	0.337	3.189	79	0.073	0.139	1ocrH.pdb.gz	Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
8	AFDB:Q9FLP3	0.176	0.103	3.256	302	0.139	0.070	Q9FLP3.pdb.gz	MGE1_ARATH GrpE protein homolog 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=Mge1 PE=2 SV=1
9	AFDB:Q5VQK9	0.153	0.096	3.470	292	0.152	0.079	Q5VQK9.pdb.gz	CEST_ORYSJ Protein CHLOROPLAST ENHANCING STRESS TOLERANCE, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CEST PE=2 SV=1
10	PDB:6o3sA	0.217	0.550	3.624	47	0.040	0.128	6o3sA.pdb.gz
11	AFDB:Q21017	0.168	0.043	3.943	822	0.179	0.033	Q21017.pdb.gz	KIN29_CAEEL Serine/threonine-protein kinase kin-29 OS=Caenorhabditis elegans OX=6239 GN=kin-29 PE=1 SV=2
12	AFDB:Q86UE8	0.126	0.030	4.775	772	0.185	0.036	Q86UE8.pdb.gz	TLK2_HUMAN Serine/threonine-protein kinase tousled-like 2 OS=Homo sapiens OX=9606 GN=TLK2 PE=1 SV=2
13	PDB:1hp8A	0.231	0.480	6.039	68	0.060	0.132	1hp8A.pdb.gz
14	PDB:2k3jA	0.231	0.510	6.862	65	0.046	0.108	2k3jA.pdb.gz
15	PDB:7qsdo	0.253	0.308	7.796	122	0.093	0.115	7qsdo.pdb.gz	Structural basis of mammalian respiratory complex I inhibition by medicinal biguanides.
16	PDB:2c5qE	0.180	0.122	8.858	233	0.046	0.030	2c5qE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9Y6H1	1.52e-73	218	151	0.940	0.940	CHCH2_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1
2	Q9D1L0	2.10e-67	203	153	0.808	0.797	CHCH2_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Mus musculus OX=10090 GN=Chchd2 PE=2 SV=1
3	Q8CEW7	1.20e-59	195	583	0.768	0.199	Q8CEW7_MOUSE DUF4371 domain-containing protein OS=Mus musculus OX=10090 GN=Zbed5 PE=2 SV=1
4	B2RPU8	1.15e-58	196	756	0.768	0.153	B2RPU8_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like OS=Mus musculus OX=10090 GN=Zbed5 PE=1 SV=1
5	D3Z5B1	1.07e-52	167	183	0.550	0.454	D3Z5B1_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 2-like (Fragment) OS=Mus musculus OX=10090 GN=Zbed5 PE=4 SV=8
6	Q6PBP6	9.49e-37	125	143	0.391	0.413	Q6PBP6_DANRE Coiled-coil-helix-coiled-coil-helix domain-containing 10 OS=Danio rerio OX=7955 GN=chchd2 PE=1 SV=1
7	Q8WYQ3	3.08e-32	113	142	0.536	0.570	CHC10_HUMAN Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
8	B5MBW9	5.04e-32	113	149	0.543	0.550	B5MBW9_HUMAN Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Homo sapiens OX=9606 GN=CHCHD10 PE=1 SV=1
9	Q8BW15	1.06e-31	112	138	0.377	0.413	Q8BW15_MOUSE Coiled-coil-helix-coiled-coil-helix domain-containing protein 10, mitochondrial OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
10	Q7TNL9	1.78e-31	111	138	0.377	0.413	Q7TNL9_MOUSE Coiled-coil-helix-coiled-coil-helix domain containing 10 OS=Mus musculus OX=10090 GN=Chchd10 PE=1 SV=1
11	Q2V056	2.19e-28	102	98	0.377	0.582	Q2V056_MOUSE CHCH domain-containing protein OS=Mus musculus OX=10090 GN=Chchd10 PE=2 SV=1
12	X2JFJ0	1.88e-23	90.5	122	0.358	0.443	X2JFJ0_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform B OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
13	Q9VX77	2.27e-23	91.7	170	0.358	0.318	Q9VX77_DROME Coiled-coil-helix-coiled-coil-helix domain containing 2, isoform A OS=Drosophila melanogaster OX=7227 GN=Chchd2 PE=1 SV=1
14	Q09254	2.32e-20	83.6	154	0.404	0.396	HAR1_CAEEL Hemiasterlin resistant protein 1 OS=Caenorhabditis elegans OX=6239 GN=har-1 PE=4 SV=1
15	Q03667	4.90e-18	77.8	156	0.397	0.385	MIX17_YEAST Mitochondrial intermembrane space cysteine motif-containing protein MIX17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MIX17 PE=1 SV=1
16	Q59WV9	4.78e-12	62.0	151	0.258	0.258	Q59WV9_CANAL Mic17p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C600920WA PE=4 SV=1
17	Q10307	3.71e-11	60.1	172	0.371	0.326	YD52_SCHPO Uncharacterized protein C6C3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC6C3.02c PE=4 SV=1
18	O75962	0.025	36.6	3097	0.159	0.008	TRIO_HUMAN Triple functional domain protein OS=Homo sapiens OX=9606 GN=TRIO PE=1 SV=2
19	Q9D6F4	0.23	33.5	552	0.172	0.047	GBRA4_MOUSE Gamma-aminobutyric acid receptor subunit alpha-4 OS=Mus musculus OX=10090 GN=Gabra4 PE=2 SV=1
20	Q8JZQ9	0.24	33.5	803	0.185	0.035	EIF3B_MOUSE Eukaryotic translation initiation factor 3 subunit B OS=Mus musculus OX=10090 GN=Eif3b PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06747 CHCH	0.4	22.1	CHCH domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_003811497.1

Rank	PPI partner	STRING score	Description
1	9597.XP_008960477.1	0.919	Coiled-coil-helix-coiled-coil-helix domain containing 10
2	9597.XP_003813507.1	0.808	Coiled-coil-helix-coiled-coil-helix domain-containing protein 3, mitochondrial isoform X1
3	9597.XP_003819369.1	0.788	NADH:ubiquinone oxidoreductase subunit A11
4	9597.XP_008966445.1	0.762	Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
5	9597.XP_003826282.1	0.731	Coiled-coil-helix-coiled-coil-helix domain containing 4
6	9597.XP_003824279.1	0.708	ATP synthase, H+ transporting, mitochondrial Fo complex subunit C3 (subunit 9)
7	9597.XP_003831849.1	0.666	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 2 codons
8	9597.XP_003814810.1	0.662	BCL2 like 1
9	9597.XP_003819762.1	0.661	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 102 ESTs, 3 Proteins, and 93% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns
10	9597.XP_003812798.1	0.653	Cytochrome b-c1 complex subunit 6, mitochondrial isoform X1
11	9597.XP_008949936.1	0.653	This is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1.
12	9597.XP_003828263.1	0.649	Belongs to the BI1 family
13	9597.XP_003819286.1	0.644	Mitochondrial import inner membrane translocase subunit Tim13
14	9597.XP_003824535.1	0.641	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 5 mRNAs, 144 ESTs, 2 Proteins, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
15	9597.XP_003825200.1	0.639	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 6 mRNAs, 186 ESTs, 4 Proteins, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 18 samples with support for all annotated introns
16	9597.XP_008975074.1	0.628	Coiled-coil-helix-coiled-coil-helix domain containing 7
17	9597.XP_003807737.2	0.614	Growth factor, augmenter of liver regeneration
18	9597.XP_003810462.1	0.613	Mitochondrial import inner membrane translocase subunit Tim8 A isoform X1
19	9597.XP_008955420.1	0.594	The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: inserted 2 bases in 1 codon
20	9597.XP_008961706.1	0.594	Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol- cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c ox [...]

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.998	heterocyclic compound binding
GO:0097159	0.998	organic cyclic compound binding
GO:0003676	0.992	nucleic acid binding
GO:0003677	0.897	DNA binding
GO:0043565	0.885	sequence-specific DNA binding
GO:0008134	0.852	transcription factor binding
GO:0140297	0.837	DNA-binding transcription factor binding
GO:0003824	0.355	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050896	0.799	response to stimulus
GO:0050789	0.710	regulation of biological process
GO:0006979	0.686	response to oxidative stress
GO:0050794	0.536	regulation of cellular process
GO:0008152	0.428	metabolic process
GO:0044237	0.377	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0070013	0.910	intracellular organelle lumen
GO:0005740	0.885	mitochondrial envelope
GO:0032991	0.473	protein-containing complex
GO:0016020	0.427	membrane
GO:0005634	0.373	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]