StarFunc result for job id Q5T1M5

User Input

>input (1219 residues)
MFGAGDEDDTDFLSPSGGARLASLFGLDQAAAGHGNEFFQYTAPKQPKKGQGTAATGNQA
TPKTAPATMSTPTILVATAVHAYRYTNGQYVKQGKFGAAVLGNHTAREYRILLYISQQQP
VTVARIHVNFELMVRPNNYSTFYDDQRQNWSIMFESEKAAVEFNKQVCIAKCNSTSSLDA
VLSQDLIVADGPAVEVGDSLEVAYTGWLFQNHVLGQVFDSTANKDKLLRLKLGSGKVIKG
WEDGMLGMKKGGKRLLIVPPACAVGSEGVIGWTQATDSILVFEVEVRRVKFARDSGSDGH
SVSSRDSAAPSPIPGADNLSADPVVSPPTSIPFKSGEPALRTKSNSLSEQLAINTSPDAV
KAKLISRMAKMGQPMLPILPPQLDSNDSEIEDVNTLQGGGQPVVTPSVQPSLHPAHPALP
QMTSQAPQPSVTGLQAPSAALMQVSSLDSHSAVSGNAQSFQPYAGMQAYAYPQASAVTSQ
LQPVRPLYPAPLSQPPHFQGSGDMASFLMTEARQHNTEIRMAVSKVADKMDHLMTKVEEL
QKHSAGNSMLIPSMSVTMETSMIMSNIQRIIQENERLKQEILEKSNRIEEQNDKISELIE
RNQRYVEQSNLMMEKRNNSLQTATENTQARVLHAEQEKAKVTEELAAATAQVSHLQLKMT
AHQKKETELQMQLTESLKETDLLRGQLTKVQAKLSELQETSEQAQSKFKSEKQNRKQLEL
KVTSLEEELTDLRVEKESLEKNLSERKKKSAQERSQAEEEIDEIRKSYQEELDKLRQLLK
KTRVSTDQAAAEQLSLVQAELQTQWEAKCEHLLASAKDEHLQQYQEVCAQRDAYQQKLVQ
LQEKCLALQAQITALTKQNEQHIKELEKNKSQMSGVEAAASDPSEKVKKIMNQVFQSLRR
EFELEESYNGRTILGTIMNTIKMVTLQLLNQQEQEKEESSSEEEEEKAEERPRRPSQEQS
ASASSGQPQAPLNRERPESPMVPSEQVVEEAVPLPPQALTTSQDGHRRKGDSEAEALSEI
KDGSLPPELSCIPSHRVLGPPTSIPPEPLGPVSMDSECEESLAASPMAAKPDNPSGKVCV
REVAPDGPLQESSTRLSLTSDPEEGDPLALGPESPGEPQPPQLKKDDVTSSTGPHKELSS
TEAGSTVAGAALRPSHHSQRSSLSGDEEDELFKGATLKALRPKAQPEEEDEDEVSMKGRP
PPTPLFGDDDDDDDIDWLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T1M5	1.000	1.000	0.000	1219	1.000	1.000	Q5T1M5.pdb.gz	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2
2	AFDB:Q6P9Q6	0.424	0.425	0.000	1216	0.797	0.799	Q6P9Q6.pdb.gz	FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX=10090 GN=Fkbp15 PE=1 SV=2
3	PDB:1fklA	0.086	0.922	3.947E-10	107	0.028	0.318	1fklA.pdb.gz	Comparative X-ray structures of the major binding protein for the immunosuppressant FK506 (tacrolimus) in unliganded form and in complex with FK506 and rapamycin.
4	PDB:4mspA	0.087	0.539	4.916E-10	189	0.028	0.180	4mspA.pdb.gz	Structure of human peptidyl-prolyl cis-trans isomerase FKBP22 containing two EF-hand motifs.
5	PDB:5hw8B	0.083	0.747	1.321E-9	122	0.030	0.303	5hw8B.pdb.gz	Structures of Pathogenic Fungal FKBP12s Reveal Possible Self-Catalysis Function.
6	PDB:1q6uA	0.088	0.469	4.670E-9	213	0.033	0.188	1q6uA.pdb.gz
7	PDB:2nd5A	0.087	0.863	4.670E-9	111	0.030	0.324	2nd5A.pdb.gz
8	PDB:7u0sA	0.087	0.800	5.212E-9	124	0.029	0.282	7u0sA.pdb.gz	Structure-Guided Synthesis of FK506 and FK520 Analogs with Increased Selectivity Exhibit In Vivo Therapeutic Efficacy against Cryptococcus.
9	PDB:4c02B	0.086	0.897	6.146E-9	108	0.029	0.324	4c02B.pdb.gz	Crystal Structure of Human Acvr1 (Alk2) in Complex with Fkbp12.6 And Dorsomorphin
10	PDB:7zw0sk	0.084	0.832	9.026E-9	114	0.030	0.325	7zw0sk.pdb.gz	Sensing of individual stalled 80S ribosomes by Fap1 for nonfunctional rRNA turnover.
11	PDB:2mphA	0.086	0.425	1.007E-8	224	0.033	0.179	2mphA.pdb.gz
12	PDB:5njxA	0.088	0.254	1.255E-8	413	0.032	0.094	5njxA.pdb.gz	Combined x-ray crystallography and computational modeling approach to investigate the Hsp90 C-terminal peptide binding to FKBP51.
13	AFDB:Q60974	0.044	0.027	2.938E-3	2453	0.114	0.057	Q60974.pdb.gz	NCOR1_MOUSE Nuclear receptor corepressor 1 OS=Mus musculus OX=10090 GN=Ncor1 PE=1 SV=1
14	AFDB:Q9Y618	0.053	0.031	3.465E-3	2514	0.124	0.060	Q9Y618.pdb.gz	NCOR2_HUMAN Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3
15	AFDB:Q57UM8	0.084	0.105	5.088E-3	904	0.078	0.105	Q57UM8.pdb.gz	Q57UM8_TRYB2 Immunodominant antigen, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.5F10.700 PE=4 SV=1
16	AFDB:D3ZXN9	0.039	0.022	1.098E-2	2472	0.132	0.065	D3ZXN9.pdb.gz	D3ZXN9_RAT Nuclear receptor co-repressor 2 OS=Rattus norvegicus OX=10116 GN=Ncor2 PE=1 SV=2
17	AFDB:P07197	0.119	0.154	1.367E-2	916	0.118	0.157	P07197.pdb.gz	NFM_HUMAN Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3
18	AFDB:A0A2R8QCI3	0.094	0.063	1.703E-2	2023	0.116	0.070	A0A2R8QCI3.pdb.gz	DAPLE_DANRE Protein Daple OS=Danio rerio OX=7955 GN=ccdc88c PE=2 SV=1
19	AFDB:A1Z8P9	0.072	0.046	1.799E-2	2346	0.119	0.062	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1
20	AFDB:Q585C9	0.097	0.093	2.241E-2	1271	0.105	0.101	Q585C9.pdb.gz	Q585C9_TRYB2 NUP-1 protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.3A7.660 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T1M5	0.0	2498	1219	1.000	1.000	FKB15_HUMAN FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15 PE=1 SV=2
2	Q6P9Q6	0.0	1877	1216	0.799	0.801	FKB15_MOUSE FK506-binding protein 15 OS=Mus musculus OX=10090 GN=Fkbp15 PE=1 SV=2
3	P73037	4.72e-15	77.4	201	0.036	0.219	P73037_SYNY3 Peptidyl-prolyl cis-trans isomerase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=ytfC PE=3 SV=1
4	P32472	3.17e-13	70.1	135	0.034	0.304	FKBP2_YEAST Peptidyl-prolyl cis-trans isomerase FPR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPR2 PE=1 SV=1
5	P54397	1.52e-12	72.8	357	0.037	0.126	FKB39_DROME 39 kDa FK506-binding nuclear protein OS=Drosophila melanogaster OX=7227 GN=Fkbp39 PE=1 SV=2
6	Q9V3V2	3.59e-12	69.3	216	0.030	0.171	Q9V3V2_DROME peptidylprolyl isomerase OS=Drosophila melanogaster OX=7227 GN=Fkbp14 PE=1 SV=1
7	Q57WF7	4.29e-12	66.2	112	0.031	0.339	Q57WF7_TRYB2 peptidylprolyl isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.28B13.650 PE=1 SV=1
8	A0A0B4K7C5	5.38e-12	68.9	220	0.030	0.168	A0A0B4K7C5_DROME peptidylprolyl isomerase OS=Drosophila melanogaster OX=7227 GN=Fkbp14 PE=1 SV=1
9	Q9XZ54	2.00e-11	68.2	256	0.030	0.145	Q9XZ54_DROME peptidylprolyl isomerase (Fragment) OS=Drosophila melanogaster OX=7227 GN=Fkbp14 PE=2 SV=2
10	O74191	1.02e-10	67.4	361	0.033	0.111	FKBP4_SCHPO FK506-binding protein 39 kDa OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=fkbp39 PE=1 SV=1
11	Q9SCY2	1.10e-10	64.7	208	0.037	0.216	FKB13_ARATH Peptidyl-prolyl cis-trans isomerase FKBP13, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FKBP13 PE=1 SV=2
12	Q93ZG9	5.68e-10	65.5	477	0.031	0.080	FKB53_ARATH Peptidyl-prolyl cis-trans isomerase FKBP53 OS=Arabidopsis thaliana OX=3702 GN=FKBP53 PE=1 SV=1
13	P26885	1.05e-09	60.5	142	0.030	0.254	FKBP2_HUMAN Peptidyl-prolyl cis-trans isomerase FKBP2 OS=Homo sapiens OX=9606 GN=FKBP2 PE=1 SV=2
14	Q5ATN7	1.15e-09	60.1	135	0.023	0.207	FKBP2_EMENI FK506-binding protein 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=fkbB PE=3 SV=1
15	P38911	2.24e-09	63.5	411	0.032	0.095	FKBP3_YEAST Peptidyl-prolyl cis-trans isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPR3 PE=1 SV=2
16	Q06205	3.27e-09	62.8	392	0.031	0.097	FKBP4_YEAST FK506-binding protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=FPR4 PE=1 SV=1
17	Q10175	6.41e-09	61.6	362	0.033	0.110	FKBPH_SCHPO Probable peptidyl-prolyl cis-trans isomerase C27F1.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27F1.06c PE=1 SV=1
18	Q8AVL7	1.08e-08	57.0	133	0.029	0.263	Q8AVL7_XENLA peptidylprolyl isomerase (Fragment) OS=Xenopus laevis OX=8355 GN=FKBP1B PE=2 SV=1
19	Q9FJL3	1.30e-08	61.6	578	0.032	0.067	FKB65_ARATH Peptidyl-prolyl cis-trans isomerase FKBP65 OS=Arabidopsis thaliana OX=3702 GN=FKBP65 PE=1 SV=1
20	Q38936	2.29e-08	57.0	163	0.029	0.215	FK152_ARATH Peptidyl-prolyl cis-trans isomerase FKBP15-2 OS=Arabidopsis thaliana OX=3702 GN=FKBP15-2 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00038 Filament	1.6	19.8	Intermediate filament protein
2	PF00254 FKBP_C	2e-17	74.6	FKBP-type peptidyl-prolyl cis-trans isomerase
3	PF15590 Imm27	7e+02	11.6	Immunity protein 27
4	PF00568 WH1	4.4	18.7	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000238256

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000402338	0.943	Ribosome production factor 2 homolog
2	9606.ENSP00000363482	0.923	WASH complex subunit 2C
3	9606.ENSP00000285814	0.913	Nucleolar protein interacting with the FHA domain of MKI67
4	9606.ENSP00000318016	0.912	WASH complex subunit 5
5	9606.ENSP00000322396	0.908	Ribosome biogenesis regulatory protein homolog
6	9606.ENSP00000455106	0.907	Ribosome biogenesis protein BOP1
7	9606.ENSP00000317992	0.902	Nucleolar complex protein 2 homolog
8	9606.ENSP00000264279	0.898	Nucleolar protein 58
9	9606.ENSP00000229214	0.897	KRR1 small subunit processome component homolog
10	9606.ENSP00000407323	0.895	Probable rRNA-processing protein EBP2
11	9606.ENSP00000370589	0.889	Nucleolar protein 56
12	9606.ENSP00000371101	0.887	Nucleolar protein 10
13	9606.ENSP00000338862	0.886	Ribosome biogenesis protein BRX1 homolog
14	9606.ENSP00000354040	0.885	Nucleolar GTP-binding protein 1
15	9606.ENSP00000274606	0.875	H/ACA ribonucleoprotein complex subunit 2
16	9606.ENSP00000358812	0.870	Protein RRP5 homolog
17	9606.ENSP00000396673	0.864	pre-rRNA processing protein FTSJ3
18	9606.ENSP00000380982	0.863	Pumilio homolog 3
19	9606.ENSP00000314348	0.861	Probable ATP-dependent RNA helicase DDX10
20	9606.ENSP00000346725	0.861	Pescadillo homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0065007	0.712	biological regulation
GO:0050789	0.461	regulation of biological process
GO:0050794	0.419	regulation of cellular process
GO:0071840	0.347	cellular component organization or biogenesis
GO:0050896	0.313	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0005737	0.994	cytoplasm
GO:0012505	0.988	endomembrane system
GO:0016020	0.972	membrane
GO:0005634	0.764	nucleus
GO:0005856	0.594	cytoskeleton
GO:0042995	0.506	cell projection
GO:0070013	0.483	intracellular organelle lumen
GO:0031982	0.480	vesicle
GO:0031981	0.470	nuclear lumen
GO:0005654	0.447	nucleoplasm
GO:0120025	0.442	plasma membrane bounded cell projection
GO:0043005	0.376	neuron projection
GO:0031410	0.349	cytoplasmic vesicle
GO:0030424	0.310	axon

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]