StarFunc result for job id Q5T1R4

User Input

>input (2406 residues)
MDPEQSVKGTKKAEGSPRKRLTKGEAIQTSVSSSVPYPGSGTAATQESPAQELLAPQPFP
GPSSVLREGSQEKTGQQQKPPKRPPIEASVHISQLPQHPLTPAFMSPGKPEHLLEGSTWQ
LVDPMRPGPSGSFVAPGLHPQSQLLPSHASIIPPEDLPGVPKVFVPRPSQVSLKPTEEAH
KKERKPQKPGKYICQYCSRPCAKPSVLQKHIRSHTGERPYPCGPCGFSFKTKSNLYKHRK
SHAHRIKAGLASGMGGEMYPHGLEMERIPGEEFEEPTEGESTDSEEETSATSGHPAELSP
RPKQPLLSSGLYSSGSHSSSHERCSLSQSSTAQSLEDPPPFVEPSSEHPLSHKPEDTHTI
KQKLALRLSERKKVIDEQAFLSPGSKGSTESGYFSRSESAEQQVSPPNTNAKSYAEIIFG
KCGRIGQRTAMLTATSTQPLLPLSTEDKPSLVPLSVPRTQVIEHITKLITINEAVVDTSE
IDSVKPRRSSLSRRSSMESPKSSLYREPLSSHSEKTKPEQSLLSLQHPPSTAPPVPLLRS
HSMPSAACTISTPHHPFRGSYSFDDHITDSEALSHSSHVFTSHPRMLKRQPAIELPLGGE
YSSEEPGPSSKDTASKPSDEVEPKESELTKKTKKGLKTKGVIYECNICGARYKKRDNYEA
HKKYYCSELQIAKPISAGTHTSPEAEKSQIEHEPWSQMMHYKLGTTLELTPLRKRRKEKS
LGDEEEPPAFESTKSQFGSPGPSDAARNLPLESTKSPAEPSKSVPSLEGPTGFQPRTPKP
GSGSESGKERRTTSKEISVIQHTSSFEKSDSLEQPSGLEGEDKPLAQFPSPPPAPHGRSA
HSLQPKLVRQPNIQVPEILVTEEPDRPDTEPEPPPKEPEKTEEFQWPQRSQTLAQLPAEK
LPPKKKRLRLAEMAQSSGESSFESSVPLSRSPSQESNVSLSGSSRSASFERDDHGKAEAP
SPSSDMRPKPLGTHMLTVPSHHPHAREMRRSASEQSPNVSHSAHMTETRSKSFDYGSLSL
TGPSAPAPVAPPARVAPPERRKCFLVRQASLSRPPESELEVAPKGRQESEEPQPSSSKPS
AKSSLSQISSAATSHGGPPGGKGPGQDRPPLGPTVPYTEALQVFHHPVAQTPLHEKPYLP
PPVSLFSFQHLVQHEPGQSPEFFSTQAMSSLLSSPYSMPPLPPSLFQAPPLPLQPTVLHP
GQLHLPQLMPHPANIPFRQPPSFLPMPYPTSSALSSGFFLPLQSQFALQLPGDVESHLPQ
IKTSLAPLATGSAGLSPSTEYSSDIRLPPVAPPASSSAPTSAPPLALPACPDTMVSLVVP
VRVQTNMPSYGSAMYTTLSQILVTQSQGSSATVALPKFEEPPSKGTTVCGADVHEVGPGP
SGLSEEQSRAFPTPYLRVPVTLPERKGTSLSSESILSLEGSSSTAGGSKRVLSPAGSLEL
TMETQQQKRVKEEEASKADEKLELVKPCSVVLTSTEDGKRPEKSHLGNQGQGRRELEMLS
SLSSDPSDTKEIPPLPHPALSHGTAPGSEALKEYPQPSGKPHRRGLTPLSVKKEDSKEQP
DLPSLAPPSSLPLSETSSRPAKSQEGTDSKKVLQFPSLHTTTNVSWCYLNYIKPNHIQHA
DRRSSVYAGWCISLYNPNLPGVSTKAALSLLRSKQKVSKETYTMATAPHPEAGRLVPSSS
RKPRMTEVHLPSLVSPEGQKDLARVEKEEERRGEPEEDAPASQRGEPARIKIFEGGYKSN
EEYVYVRGRGRGKYVCEECGIRCKKPSMLKKHIRTHTDVRPYVCKHCHFAFKTKGNLTKH
MKSKAHSKKCQETGVLEELEAEEGTSDDLFQDSEGREGSEAVEEHQFSDLEDSDSDSDLD
EDEDEDEEESQDELSRPSSEAPPPGPPHALRADSSPILGPQPPDAPASGTEATRGSSVSE
AERLTASSCSMSSQSMPGLPWLGPAPLGSVEKDTGSALSYKPVSPRRPWSPSKEAGSRPP
LARKHSLTKNDSSPQRCSPAREPQASAPSPPGLHVDPGRGMGALPCGSPRLQLSPLTLCP
LGRELAPRAHVLSKLEGTTDPGLPRYSPTRRWSPGQAESPPRSAPPGKWALAGPGSPSAG
EHGPGLGLDPRVLFPPAPLPHKLLSRSPETCASPWQKAESRSPSCSPGPAHPLSSRPFSA
LHDFHGHILARTEENIFSHLPLHSQHLTRAPCPLIPIGGIQMVQARPGAHPTLLPGPTAA
WVSGFSGGGSDLTGAREAQERGRWSPTESSSASVSPVAKVSKFTLSSELEGGDYPKERER
TGGGPGRPPDWTPHGTGAPAEPTPTHSPCTPPDTLPRPPQGRRAAQSWSPRLESPRAPTN
PEPSATPPLDRSSSVGCLAEASARFPARTRNLSGEPRTRQDSPKPSGSGEPRAHPHQPED
RVPPNA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2A884	0.090	0.091	0.000	2348	0.800	0.820	A2A884.pdb.gz	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
2	AFDB:Q5T1R4	0.999	0.999	0.000	2406	1.000	1.000	Q5T1R4.pdb.gz	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
3	AFDB:P31629	0.145	0.143	8.344E-71	2446	0.352	0.347	P31629.pdb.gz	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
4	AFDB:F1M9H4	0.064	0.068	9.692E-35	2110	0.253	0.289	F1M9H4.pdb.gz	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
5	AFDB:Q92766	0.042	0.051	1.588E-7	1687	0.125	0.178	Q92766.pdb.gz	RREB1_HUMAN Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3
6	AFDB:A0A0R4INF0	0.036	0.050	1.622E-6	1570	0.094	0.145	A0A0R4INF0.pdb.gz	A0A0R4INF0_DANRE Zinc finger and BTB domain-containing 4 OS=Danio rerio OX=7955 GN=zbtb4 PE=4 SV=1
7	AFDB:Q0GGX2	0.030	0.053	1.135E-4	1363	0.083	0.146	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
8	AFDB:Q9H0D2	0.042	0.065	3.283E-4	1346	0.082	0.146	Q9H0D2.pdb.gz	ZN541_HUMAN Zinc finger protein 541 OS=Homo sapiens OX=9606 GN=ZNF541 PE=1 SV=3
9	AFDB:Q90ZW5	0.025	0.042	7.782E-4	1261	0.089	0.170	Q90ZW5.pdb.gz	Q90ZW5_CHICK Spalt 2 protein OS=Gallus gallus OX=9031 GN=SAL2 PE=1 SV=1
10	AFDB:Q9VNE0	0.029	0.030	8.316E-4	2296	0.128	0.134	Q9VNE0.pdb.gz	Q9VNE0_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG2926 PE=1 SV=1
11	PDB:3w5kB	0.017	0.216	1.696E-1	110	0.008	0.173	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:4v6wCj	0.016	0.179	3.363	92	0.006	0.152	4v6wCj.pdb.gz	Structures of the human and Drosophila 80S ribosome.
13	PDB:7pntO	0.021	0.150	3.363	197	0.005	0.066	7pntO.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
14	PDB:6htsR	0.011	0.236	4.104	72	0.007	0.236	6htsR.pdb.gz	Structure and regulation of the human INO80-nucleosome complex.
15	PDB:4r8pL	0.012	0.080	4.385	254	0.003	0.031	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
16	PDB:1rquA	0.014	0.145	5.719	120	0.003	0.058	1rquA.pdb.gz
17	PDB:4btsA9	0.013	0.193	5.719	93	0.008	0.215	4btsA9.pdb.gz	The crystal structure of the eukaryotic 40S ribosomal subunit in complex with eIF1 and eIF1A.
18	PDB:4v6iBl	0.017	0.157	6.979	88	0.004	0.114	4v6iBl.pdb.gz	Cryo-EM structure and rRNA model of a translating eukaryotic 80S ribosome at 5.5-A resolution.
19	PDB:6xu6Cj	0.017	0.142	6.979	87	0.004	0.115	6xu6Cj.pdb.gz	Ribosome heterogeneity in Drosophila melanogaster gonads through paralog-switching.
20	PDB:5lj5t	0.011	0.045	7.970	438	0.001	0.007	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2A884	0.0	3320	2348	0.799	0.819	ZEP3_MOUSE Transcription factor HIVEP3 OS=Mus musculus OX=10090 GN=Hivep3 PE=1 SV=1
2	Q00900	0.0	831	2437	0.318	0.314	ZEP2_RAT Human immunodeficiency virus type I enhancer-binding protein 2 homolog OS=Rattus norvegicus OX=10116 GN=Hivep2 PE=1 SV=2
3	Q5T1R4	0.0	4777	2406	1.000	1.000	ZEP3_HUMAN Transcription factor HIVEP3 OS=Homo sapiens OX=9606 GN=HIVEP3 PE=1 SV=1
4	F1M9H4	1.93e-101	368	2574	0.160	0.149	F1M9H4_RAT HIVEP zinc finger 1 OS=Rattus norvegicus OX=10116 GN=Hivep1 PE=1 SV=3
5	P31629	7.86e-86	317	2446	0.066	0.065	ZEP2_HUMAN Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2
6	Q3UHF7	3.60e-83	308	2430	0.066	0.065	ZEP2_MOUSE Transcription factor HIVEP2 OS=Mus musculus OX=10090 GN=Hivep2 PE=1 SV=1
7	F5H212	1.01e-79	297	2717	0.119	0.106	F5H212_HUMAN HIVEP zinc finger 1 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=2
8	P15822	1.07e-79	297	2718	0.119	0.106	ZEP1_HUMAN Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=4
9	F8VPM9	5.36e-72	272	2688	0.091	0.081	F8VPM9_MOUSE Human immunodeficiency virus type I enhancer binding protein 1 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
10	Q03172	5.36e-72	272	2688	0.091	0.081	ZEP1_MOUSE Zinc finger protein 40 OS=Mus musculus OX=10090 GN=Hivep1 PE=1 SV=1
11	Q0E9C5	1.37e-41	172	2532	0.052	0.049	Q0E9C5_DROME Schnurri, isoform A OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
12	Q24107	1.47e-41	172	2527	0.052	0.049	Q24107_DROME Transcription factor OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
13	A0A0B4KFC0	1.55e-41	171	2587	0.052	0.048	A0A0B4KFC0_DROME Schnurri, isoform F OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
14	Q24605	1.58e-41	171	2529	0.052	0.049	Q24605_DROME Zinc finger protein OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
15	A1Z8F4	1.94e-41	171	2577	0.052	0.048	A1Z8F4_DROME Schnurri, isoform D OS=Drosophila melanogaster OX=7227 GN=shn PE=1 SV=1
16	Q7JM44	6.34e-32	140	2242	0.026	0.028	SMA9_CAEEL Transcription factor sma-9 OS=Caenorhabditis elegans OX=6239 GN=sma-9 PE=1 SV=2
17	Q8MQL7	2.98e-22	106	585	0.017	0.070	Q8MQL7_DROME SD06302p OS=Drosophila melanogaster OX=7227 GN=shn PE=2 SV=1
18	Q9UJQ4	4.43e-10	67.8	1053	0.015	0.034	SALL4_HUMAN Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4 PE=1 SV=1
19	P39770	5.54e-10	67.8	1365	0.012	0.021	SALM_DROME Homeotic protein spalt-major OS=Drosophila melanogaster OX=7227 GN=salm PE=1 SV=3
20	Q8BX22	1.37e-09	66.2	1067	0.018	0.041	SALL4_MOUSE Sal-like protein 4 OS=Mus musculus OX=10090 GN=Sall4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00096 zf-C2H2	2e-16	70.6	Zinc finger, C2H2 type
2	PF13894 zf-C2H2_4	4.5e-06	38.0	C2H2-type zinc finger
3	PF12171 zf-C2H2_jaz	0.0012	30.3	Zinc-finger double-stranded RNA-binding
4	PF13465 zf-H2C2_2	9.3e-06	37.1	Zinc-finger double domain
5	PF13909 zf-H2C2_5	0.29	22.2	C2H2-type zinc-finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361664

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000427793	0.968	NEDD4-like E3 ubiquitin-protein ligase WWP1
2	9606.ENSP00000304697	0.905	Polyubiquitin-B
3	9606.ENSP00000441543	0.905	Polyubiquitin-C
4	9606.ENSP00000272317	0.903	Ubiquitin-40S ribosomal protein S27a
5	9606.ENSP00000388107	0.901	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000360493	0.857	Runt-related transcription factor 2
7	9606.ENSP00000360381	0.811	CUB domain containing protein 2
8	9606.ENSP00000294383	0.782	Ubiquitin carboxyl-terminal hydrolase 24
9	9606.ENSP00000371875	0.781	Homeobox protein Nkx-3.2
10	9606.ENSP00000349594	0.720	ELAV-like protein 4
11	9606.ENSP00000222598	0.716	Homeobox protein DLX-5
12	9606.ENSP00000354671	0.716	Microtubule-associated serine/threonine-protein kinase 2
13	9606.ENSP00000384851	0.689	Steroid hormone receptor ERR1
14	9606.ENSP00000239243	0.686	Homeobox protein MSX-2
15	9606.ENSP00000405330	0.680	Estrogen receptor
16	9606.ENSP00000231509	0.674	Glucocorticoid receptor
17	9606.ENSP00000242261	0.674	Twist-related protein 1
18	9606.ENSP00000428480	0.657	Homeobox protein DLX-6
19	9606.ENSP00000415151	0.656	Core-binding factor subunit beta
20	9606.ENSP00000264867	0.655	Peroxisome proliferator-activated receptor gamma coactivator 1-alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.922	heterocyclic compound binding
GO:0097159	0.893	organic cyclic compound binding
GO:0003676	0.881	nucleic acid binding
GO:0003677	0.869	DNA binding
GO:0043565	0.694	sequence-specific DNA binding
GO:0003690	0.660	double-stranded DNA binding
GO:0140110	0.600	transcription regulator activity
GO:1990837	0.560	sequence-specific double-stranded DNA binding
GO:0003700	0.529	DNA-binding transcription factor activity
GO:0000976	0.477	transcription cis-regulatory region binding
GO:0000981	0.464	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.391	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.345	cis-regulatory region sequence-specific DNA binding
GO:0000978	0.332	RNA polymerase II cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0031323	0.978	regulation of cellular metabolic process
GO:0080090	0.975	regulation of primary metabolic process
GO:0051171	0.975	regulation of nitrogen compound metabolic process
GO:0048518	0.971	positive regulation of biological process
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0048522	0.944	positive regulation of cellular process
GO:0060255	0.937	regulation of macromolecule metabolic process
GO:0010468	0.931	regulation of gene expression
GO:0009889	0.930	regulation of biosynthetic process
GO:0045893	0.919	positive regulation of DNA-templated transcription
GO:0009987	0.917	cellular process
GO:0032502	0.583	developmental process
GO:0048856	0.440	anatomical structure development
GO:0006357	0.360	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0031974	0.975	membrane-enclosed lumen
GO:0031981	0.965	nuclear lumen
GO:0005654	0.908	nucleoplasm
GO:0032991	0.350	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]