StarFunc result for job id Q5T1V6

User Input

>input (619 residues)
MFVPRSLKIKRNANDDGKSCVAKIIKPDPEDLQLDKSRDVPVDAVATEAATIDRHISESC
PFPSPGGQLAEVHSVSPEQGAKDSHPSEEPVKSFSKTQRWAEPGEPICVVCGRYGEYICD
KTDEDVCSLECKAKHLLQVKEKEEKSKLSNPQKADSEPESPLNASYVYKEHPFILNLQED
QIENLKQQLGILVQGQEVTRPIIDFEHCSLPEVLNHNLKKSGYEVPTPIQMQMIPVGLLG
RDILASADTGSGKTAAFLLPVIMRALFESKTPSALILTPTRELAIQIERQAKELMSGLPR
MKTVLLVGGLPLPPQLYRLQQHVKVIIATPGRLLDIIKQSSVELCGVKIVVVDEADTMLK
MGFQQQVLDILENIPNDCQTILVSATIPTSIEQLASQLLHNPVRIITGEKNLPCANVRQI
ILWVEDPAKKKKLFEILNDKKLFKPPVLVFVDCKLGADLLSEAVQKITGLKSISIHSEKS
QIERKNILKGLLEGDYEVVVSTGVLGRGLDLISVRLVVNFDMPSSMDEYVHQIGRVGRLG
QNGTAITFINNNSKRLFWDIAKRVKPTGSILPPQLLNSPYLHDQKRKEQQKDKQTQNDLV
TGANLMDIIRKHDKSNSQK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8W4R3	0.652	0.682	4.984E-43	591	0.254	0.266	Q8W4R3.pdb.gz	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
2	AFDB:Q9VHP0	0.611	0.476	8.012E-42	798	0.278	0.216	Q9VHP0.pdb.gz	DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster OX=7227 GN=bel PE=1 SV=1
3	AFDB:C8V8H4	0.607	0.563	1.015E-41	668	0.252	0.234	C8V8H4.pdb.gz	DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ded1 PE=3 SV=1
4	AFDB:Q9VJ74	0.632	0.478	1.015E-41	822	0.263	0.198	Q9VJ74.pdb.gz	Q9VJ74_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10333 PE=1 SV=2
5	AFDB:Q84W89	0.616	0.602	1.077E-41	633	0.289	0.283	Q84W89.pdb.gz	RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana OX=3702 GN=RH37 PE=2 SV=2
6	AFDB:A0A0C4DG89	0.654	0.397	1.212E-41	1032	0.273	0.164	A0A0C4DG89.pdb.gz	A0A0C4DG89_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=1
7	AFDB:Q91VN6	0.634	0.631	1.727E-41	622	0.260	0.259	Q91VN6.pdb.gz	DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus OX=10090 GN=Ddx41 PE=1 SV=2
8	AFDB:Q9M2F9	0.616	0.590	1.944E-41	646	0.268	0.257	Q9M2F9.pdb.gz	RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana OX=3702 GN=RH52 PE=1 SV=1
9	AFDB:Q95QN2	0.629	0.535	2.062E-41	730	0.268	0.227	Q95QN2.pdb.gz	Q95QN2_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-23 PE=1 SV=1
10	AFDB:P19109	0.649	0.560	3.119E-41	719	0.263	0.227	P19109.pdb.gz	DDX17_DROME ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3
11	PDB:7evoE	0.345	0.464	1.007E-38	455	0.246	0.334	7evoE.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
12	PDB:6qw65X	0.397	0.420	1.358E-36	583	0.246	0.261	6qw65X.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:7evnE	0.390	0.495	7.569E-34	486	0.236	0.300	7evnE.pdb.gz	Mechanisms of the RNA helicases DDX42 and DDX46 in human U2 snRNP assembly.
14	PDB:3ex7C	0.564	0.876	2.197E-32	392	0.192	0.304	3ex7C.pdb.gz	Mechanism of ATP turnover inhibition in the EJC
15	PDB:7oqbp	0.392	0.541	6.765E-31	444	0.195	0.273	7oqbp.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
16	PDB:7pliA	0.533	0.715	9.091E-31	457	0.200	0.271	7pliA.pdb.gz	Structural basis for RNA-duplex unwinding by the DEAD-box helicase DbpA.
17	PDB:7pq0B	0.341	0.538	3.762E-29	385	0.181	0.291	7pq0B.pdb.gz
18	PDB:1fuuB	0.333	0.534	1.855E-28	380	0.178	0.289	1fuuB.pdb.gz
19	PDB:5zwny	0.307	0.469	2.994E-25	399	0.202	0.313	5zwny.pdb.gz	Structures of the fully assembledSaccharomyces cerevisiaespliceosome before activation
20	PDB:7v2yF	0.398	0.596	1.035E-24	376	0.174	0.287	7v2yF.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q95QN2	1.03e-87	290	730	0.260	0.221	Q95QN2_CAEEL RNA helicase OS=Caenorhabditis elegans OX=6239 GN=ddx-23 PE=1 SV=1
2	Q95SF2	4.31e-84	278	641	0.263	0.254	Q95SF2_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=CG10333 PE=2 SV=1
3	Q8W4R3	3.71e-83	274	591	0.242	0.254	RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana OX=3702 GN=RH30 PE=1 SV=2
4	Q9VJ74	5.99e-83	279	822	0.250	0.189	Q9VJ74_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10333 PE=1 SV=2
5	Q9BUQ8	1.22e-81	276	820	0.247	0.187	DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens OX=9606 GN=DDX23 PE=1 SV=3
6	Q580H2	4.05e-80	265	569	0.242	0.264	Q580H2_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29O9.160 PE=3 SV=1
7	M9PBB5	4.38e-79	265	661	0.241	0.225	M9PBB5_DROME RNA helicase OS=Drosophila melanogaster OX=7227 GN=vas PE=3 SV=1
8	P09052	4.38e-79	265	661	0.241	0.225	VASA1_DROME ATP-dependent RNA helicase vasa OS=Drosophila melanogaster OX=7227 GN=vas PE=1 SV=3
9	Q4TVV3	4.44e-78	269	1018	0.250	0.152	DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio OX=7955 GN=ddx46 PE=2 SV=1
10	Q9P7C7	3.70e-77	266	1014	0.255	0.156	PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=prp11 PE=1 SV=1
11	P24782	4.18e-77	257	550	0.228	0.256	DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dbp2 PE=2 SV=2
12	P24783	4.00e-76	254	546	0.231	0.262	DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP2 PE=1 SV=1
13	Q9VHP0	1.29e-75	259	798	0.242	0.188	DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster OX=7227 GN=bel PE=1 SV=1
14	E3MYG7	2.04e-75	256	686	0.249	0.224	E3MYG7_CAERE RNA helicase OS=Caenorhabditis remanei OX=31234 GN=Cre-vbh-1 PE=3 SV=1
15	Q62780	5.90e-75	261	1032	0.254	0.152	DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus OX=10116 GN=Ddx46 PE=1 SV=1
16	A0A0C4DG89	7.87e-75	260	1032	0.254	0.152	A0A0C4DG89_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=1
17	Q7L014	8.61e-75	260	1031	0.254	0.152	DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2
18	P24784	1.10e-74	252	617	0.228	0.229	DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DBP1 PE=1 SV=2
19	Q388E8	1.11e-74	253	660	0.233	0.218	Q388E8_TRYB2 Probable eukaryotic initiation factor 4A OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2130 PE=3 SV=1
20	Q8H136	2.36e-74	251	619	0.236	0.236	RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=Arabidopsis thaliana OX=3702 GN=RH14 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00270 DEAD	1.6e-40	150.3	DEAD/DEAH box helicase
2	PF00271 Helicase_C	2.8e-17	74.4	Helicase conserved C-terminal domain
3	PF04851 ResIII	0.92	21.0	Type III restriction enzyme, res subunit
4	PF07517 SecA_DEAD	1.4e+02	13.1	SecA DEAD-like domain
5	PF05621 TniB	3.3e+02	12.1	Bacterial TniB protein
6	PF13368 Toprim_C_rpt	2.7e+02	13.0	Topoisomerase C-terminal repeat
7	PF04438 zf-HIT	0.00013	33.0	HIT zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330460

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381270	0.810	Protein broad-minded
2	9606.ENSP00000389014	0.776	Protein JBTS17
3	9606.ENSP00000363746	0.708	WD repeat-containing protein 46
4	9606.ENSP00000284690	0.701	Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32
5	9606.ENSP00000311135	0.685	Probable ATP-dependent RNA helicase DHX37
6	9606.ENSP00000336741	0.672	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15
7	9606.ENSP00000481495	0.662	ATP-dependent RNA helicase DDX24
8	9606.ENSP00000483495	0.661	Probable ATP-dependent RNA helicase DDX27
9	9606.ENSP00000258173	0.647	Transmembrane protein 231
10	9606.ENSP00000247003	0.645	Probable ATP-dependent RNA helicase DDX49
11	9606.ENSP00000323858	0.643	ATP-dependent RNA helicase DDX54
12	9606.ENSP00000370589	0.640	Nucleolar protein 56
13	9606.ENSP00000238146	0.631	ATP-dependent RNA helicase DDX55
14	9606.ENSP00000264279	0.631	Nucleolar protein 58
15	9606.ENSP00000359606	0.628	Box C/D snoRNA protein 1
16	9606.ENSP00000360412	0.621	Nucleolar complex protein 3 homolog
17	9606.ENSP00000354040	0.616	Nucleolar GTP-binding protein 1
18	9606.ENSP00000455106	0.612	Ribosome biogenesis protein BOP1
19	9606.ENSP00000483364	0.611	Tectonic-3
20	9606.ENSP00000361232	0.610	Probable ATP-dependent RNA helicase DDX31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140640	0.998	catalytic activity, acting on a nucleic acid
GO:0005515	0.996	protein binding
GO:0003676	0.995	nucleic acid binding
GO:0140657	0.992	ATP-dependent activity
GO:0003723	0.991	RNA binding
GO:0140098	0.961	catalytic activity, acting on RNA
GO:0004386	0.954	helicase activity
GO:0008186	0.939	ATP-dependent activity, acting on RNA
GO:0003724	0.614	RNA helicase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.994	primary metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:0016070	0.975	RNA metabolic process
GO:0071840	0.955	cellular component organization or biogenesis
GO:0006396	0.948	RNA processing
GO:0044085	0.930	cellular component biogenesis
GO:0022613	0.879	ribonucleoprotein complex biogenesis
GO:0000377	0.864	RNA splicing, via transesterification reactions with bulged adenosine as nucleophile
GO:0016071	0.695	mRNA metabolic process
GO:0050789	0.525	regulation of biological process
GO:0050794	0.361	regulation of cellular process
GO:0016043	0.333	cellular component organization
GO:0019222	0.317	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.983	nuclear lumen
GO:0005829	0.982	cytosol
GO:0043232	0.975	intracellular non-membrane-bounded organelle
GO:0005654	0.945	nucleoplasm
GO:0032991	0.394	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.4.13	0.614	RNA helicase.

[back to server]