StarFunc result for job id Q5T200

User Input

>input (1668 residues)
MSKIRRKVTVENTKTISDSTSRRPSVFERLGPSTGSTAETQCRNWLKTGNCLYGNTCRFV
HGPSPRGKGYSSNYRRSPERPTGDLRERMKNKRQDVDTEPQKRNTEESSSPVRKESSRGR
HREKEDIKITKERTPESEEENVEWETNRDDSDNGDINYDYVHELSLEMKRQKIQRELMKL
EQENMEKREEIIIKKEVSPEVVRSKLSPSPSLRKSSKSPKRKSSPKSSSASKKDRKTSAV
SSPLLDQQRNSKTNQSKKKGPRTPSPPPPIPEDIALGKKYKEKYKVKDRIEEKTRDGKDR
GRDFERQREKRDKPRSTSPAGQHHSPISSRHHSSSSQSGSSIQRHSPSPRRKRTPSPSYQ
RTLTPPLRRSASPYPSHSLSSPQRKQSPPRHRSPMREKGRHDHERTSQSHDRRHERREDT
RGKRDREKDSREEREYEQDQSSSRDHRDDREPRDGRDRRDARDTRDRRELRDSRDMRDSR
EMRDYSRDTKESRDPRDSRSTRDAHDYRDREGRDTHRKEDTYPEESRSYGRNHLREESSR
TEIRNESRNESRSEIRNDRMGRSRGRVPELPEKGSRGSRGSQIDSHSSNSNYHDSWETRS
SYPERDRYPERDNRDQARDSSFERRHGERDRRDNRERDQRPSSPIRHQGRNDELERDERR
EERRVDRVDDRRDERARERDRERERDRERERERERERDREREKERELERERARERERERE
KERDRERDRDRDHDRERERERERDREKEREREREERERERERERERERERERERERARER
DKERERQRDWEDKDKGRDDRREKREEIREDRNPRDGHDERKSKKRYRNEGSPSPRQSPKR
RREHSPDSDAYNSGDDKNEKHRLLSQVVRPQESRSLSPSHLTEDRQGRWKEEDRKPERKE
SSRRYEEQELKEKVSSVDKQREQTEILESSRMRAQDIIGHHQSEDRETSDRAHDENKKKA
KIQKKPIKKKKEDDVGIERGNIETTSEDGQVFSPKKGQKKKSIEKKRKKSKGDSDISDEE
AAQQSKKKRGPRTPPITTKEELVEMCNGKNGILEDSQKKEDTAFSDWSDEDVPDRTEVTE
AEHTATATTPGSTPSPLSSLLPPPPPVATATATTVPATLAATTAAAATSFSTSAITISTS
ATPTNTTNNTFANEDSHRKCHRTRVEKVETPHVTIEDAQHRKPMDQKRSSSLGSNRSNRS
HTSGRLRSPSNDSAHRSGDDQSGRKRVLHSGSRDREKTKSLEITGERKSRIDQLKRGEPS
RSTSSDRQDSRSHSSRRSSPESDRQVHSRSGSFDSRDRLQERDRYEHDRERERERRDTRQ
REWDRDADKDWPRNRDRDRLRERERERERDKRRDLDRERERLISDSVERDRDRDRDRTFE
SSQIESVKRCEAKLEGEHERDLESTSRDSLALDKERMDKDLGSVQGFEETNKSERTESLE
GDDESKLDDAHSLGSGAGEGYEPISDDELDEILAGDAEKREDQQDEEKMPDPLDVIDVDW
SGLMPKHPKEPREPGAALLKFTPGAVMLRVGISKKLAGSELFAKVKETCQRLLEKPKDAD
NLFEHELGALNMAALLRKEERASLLSNLGPCCKALCFRRDSAIRKQLVKNEKGTIKQAYT
SAPMVDNELLRLSLRLFKRKTTCHAPGHEKTEDNKLSQSSIQQELCVS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9Q784	0.124	0.122	0.000	1729	0.863	0.833	E9Q784.pdb.gz	ZC3HD_MOUSE Zinc finger CCCH domain-containing protein 13 OS=Mus musculus OX=10090 GN=Zc3h13 PE=1 SV=1
2	AFDB:Q5T200	1.000	1.000	0.000	1668	1.000	1.000	Q5T200.pdb.gz	ZC3HD_HUMAN Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1
3	AFDB:Q7KHG2	0.041	0.045	4.474E-4	1486	0.089	0.100	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
4	AFDB:E9Q7M2	0.044	0.079	2.725E-3	769	0.067	0.144	E9Q7M2.pdb.gz	T22D2_MOUSE TSC22 domain family protein 2 OS=Mus musculus OX=10090 GN=Tsc22d2 PE=1 SV=1
5	AFDB:O70608	0.035	0.037	4.280E-3	1505	0.103	0.114	O70608.pdb.gz	SYCP2_RAT Synaptonemal complex protein 2 OS=Rattus norvegicus OX=10116 GN=Sycp2 PE=1 SV=1
6	AFDB:Q9VU76	0.042	0.042	4.565E-3	1657	0.124	0.125	Q9VU76.pdb.gz	Q9VU76_DROME Combover, isoform A OS=Drosophila melanogaster OX=7227 GN=cmb PE=1 SV=2
7	AFDB:A1Z7Z9	0.030	0.042	4.869E-3	1134	0.076	0.112	A1Z7Z9.pdb.gz	CP131_DROME Centrosomal protein of 131 kDa OS=Drosophila melanogaster OX=7227 GN=dila PE=2 SV=2
8	AFDB:F4HXQ7	0.031	0.042	8.159E-3	1113	0.068	0.102	F4HXQ7.pdb.gz	MYOB1_ARATH Myosin-binding protein 1 OS=Arabidopsis thaliana OX=3702 GN=MYOB1 PE=1 SV=1
9	AFDB:E9Q842	0.049	0.038	9.283E-3	2432	0.129	0.088	E9Q842.pdb.gz	E9Q842_MOUSE Neuron navigator 2 OS=Mus musculus OX=10090 GN=Nav2 PE=1 SV=1
10	AFDB:Q5TZ18	0.045	0.037	1.458E-2	2269	0.129	0.095	Q5TZ18.pdb.gz	NAV3_DANRE Neuron navigator 3 OS=Danio rerio OX=7955 GN=nav3 PE=1 SV=1
11	PDB:7dvqM	0.018	0.137	1.566E-1	191	0.010	0.084	7dvqM.pdb.gz	Structure of the activated human minor spliceosome.
12	PDB:5gm6a	0.019	0.199	2.986E-1	123	0.009	0.122	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
13	PDB:6ahd1	0.029	0.043	1.234	1048	0.012	0.019	6ahd1.pdb.gz	Structures of the human pre-catalytic spliceosome and its precursor spliceosome.
14	PDB:3euhB	0.026	0.083	3.046	321	0.018	0.093	3euhB.pdb.gz
15	PDB:6ff4t	0.018	0.146	4.206	172	0.008	0.076	6ff4t.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
16	PDB:3zqqC	0.029	0.117	4.785	134	0.011	0.142	3zqqC.pdb.gz
17	PDB:5oqmm	0.022	0.176	4.785	103	0.008	0.136	5oqmm.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
18	PDB:4v8mBT	0.032	0.141	5.104	199	0.016	0.136	4v8mBT.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
19	PDB:5n9jE	0.034	0.131	5.807	201	0.016	0.134	5n9jE.pdb.gz
20	PDB:7o9kI	0.033	0.119	6.607	212	0.017	0.132	7o9kI.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9Q784	0.0	711	1729	0.276	0.266	ZC3HD_MOUSE Zinc finger CCCH domain-containing protein 13 OS=Mus musculus OX=10090 GN=Zc3h13 PE=1 SV=1
2	Q5T200	0.0	3289	1668	1.000	1.000	ZC3HD_HUMAN Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1
3	F1QBY1	3.51e-09	64.7	2876	0.034	0.019	NIPLB_DANRE Nipped-B-like protein B OS=Danio rerio OX=7955 GN=nipblb PE=2 SV=1
4	F1RAH8	4.10e-09	63.2	450	0.031	0.116	F1RAH8_DANRE RNA-binding motif protein X-linked 2 OS=Danio rerio OX=7955 GN=im:7141316 PE=4 SV=1
5	Q4QRG7	4.97e-09	63.2	434	0.041	0.157	Q4QRG7_DANRE RNA-binding motif protein, X-linked 2 OS=Danio rerio OX=7955 GN=zgc:113884 PE=2 SV=1
6	Q9LFE0	1.10e-07	59.3	820	0.034	0.070	DOT2_ARATH SART-1 family protein DOT2 OS=Arabidopsis thaliana OX=3702 GN=DOT2 PE=1 SV=1
7	Q9HCD5	1.34e-06	55.5	579	0.029	0.085	NCOA5_HUMAN Nuclear receptor coactivator 5 OS=Homo sapiens OX=9606 GN=NCOA5 PE=1 SV=2
8	A0A2R6X6S3	7.43e-06	53.5	911	0.034	0.061	SOK_MARPO Protein SOSEKI OS=Marchantia polymorpha OX=3197 GN=SOK PE=1 SV=1
9	O23212	7.46e-05	50.1	573	0.020	0.059	U2A2A_ARATH Splicing factor U2af large subunit A OS=Arabidopsis thaliana OX=3702 GN=U2AF65A PE=1 SV=2
10	Q9VRM6	5.99e-04	47.4	1929	0.031	0.027	Q9VRM6_DROME Lethal (3) persistent salivary gland 2 OS=Drosophila melanogaster OX=7227 GN=l(3)psg2 PE=4 SV=2
11	M9ND00	0.001	45.8	1190	0.016	0.022	M9ND00_DROME Dynamin associated protein 160, isoform D OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
12	Q1WWC9	0.001	45.8	1096	0.018	0.027	Q1WWC9_DROME Dynamin associated protein 160, isoform C OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
13	M9PBF6	0.002	45.8	1088	0.018	0.028	M9PBF6_DROME Dynamin associated protein 160, isoform G OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
14	M9PDC7	0.002	45.4	1005	0.018	0.030	M9PDC7_DROME Dynamin associated protein 160, isoform H OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
15	O61618	0.002	45.4	1094	0.018	0.027	O61618_DROME Dynamin associated protein isoform Dap160-1 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
16	O61639	0.002	45.4	1011	0.018	0.030	O61639_DROME Dynamin associated protein isoform Dap160-2 OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=2 SV=1
17	Q8INU2	0.002	45.4	1014	0.018	0.030	Q8INU2_DROME Dynamin associated protein 160, isoform B OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
18	Q9VIF7	0.002	45.8	1097	0.018	0.027	Q9VIF7_DROME Dynamin associated protein 160, isoform A OS=Drosophila melanogaster OX=7227 GN=Dap160 PE=1 SV=1
19	Q5HZG4	0.003	45.1	932	0.019	0.034	TAF3_MOUSE Transcription initiation factor TFIID subunit 3 OS=Mus musculus OX=10090 GN=Taf3 PE=1 SV=2
20	A8T6P4	0.004	44.3	838	0.034	0.067	MYRIP_DANRE Rab effector MyRIP OS=Danio rerio OX=7955 GN=myrip PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00642 zf-CCCH	0.0013	29.8	Zinc finger C-x8-C-x5-C-x3-H type (and similar)
2	PF14608 zf-CCCH_2	25	16.8	RNA-binding, Nab2-type zinc finger
3	PF18044 zf-CCCH_4	9	17.5	CCCH-type zinc finger
4	PF18345 zf_CCCH_4	0.0051	28.1	Zinc finger domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000005382

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000012892	0.937	SAP domain containing ribonucleoprotein
2	9593.ENSGGOP00000006720	0.932	Vir like m6A methyltransferase associated
3	9593.ENSGGOP00000003592	0.929	RNA binding motif protein 15
4	9593.ENSGGOP00000005911	0.920	Wilms tumor 1 associated protein
5	9593.ENSGGOP00000023122	0.920	Uncharacterized protein
6	9593.ENSGGOP00000011833	0.919	THO complex 3
7	9593.ENSGGOP00000002968	0.910	THO complex 1
8	9593.ENSGGOP00000003706	0.908	THO complex 5
9	9593.ENSGGOP00000001362	0.891	Nuclear cap binding protein subunit 1, 80kDa
10	9593.ENSGGOP00000005303	0.884	DExD-box helicase 39A
11	9593.ENSGGOP00000005862	0.884	DExD-box helicase 39B
12	9593.ENSGGOP00000013592	0.880	Aly/REF export factor
13	9593.ENSGGOP00000014602	0.880	Polymerase (DNA-directed), delta interacting protein 3
14	9593.ENSGGOP00000005058	0.873	THO complex 6 homolog (Drosophila)
15	9593.ENSGGOP00000025050	0.866	THO complex 7 homolog (Drosophila)
16	9593.ENSGGOP00000011461	0.847	Carbohydrate sulfotransferase 10
17	9593.ENSGGOP00000013515	0.826	DEAD-box helicase 46
18	9593.ENSGGOP00000001978	0.814	Carboxypeptidase B2 (plasma)
19	9593.ENSGGOP00000022004	0.813	ADP-ribosylation factor-like 4C
20	9593.ENSGGOP00000015346	0.804	Minichromosome maintenance complex component 3 associated protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	1.000	cellular process
GO:0008150	1.000	biological_process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.985	cellular metabolic process
GO:0043170	0.985	macromolecule metabolic process
GO:0006807	0.983	nitrogen compound metabolic process
GO:0032259	0.977	methylation
GO:0043412	0.976	macromolecule modification
GO:0016071	0.974	mRNA metabolic process
GO:0043414	0.973	macromolecule methylation
GO:0009451	0.973	RNA modification
GO:0001510	0.962	RNA methylation
GO:0016556	0.955	mRNA modification
GO:0050789	0.658	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0036396	1.000	RNA N6-methyladenosine methyltransferase complex
GO:0016607	1.000	nuclear speck
GO:0005737	0.605	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]