StarFunc result for job id Q5T215

User Input

>input (181 residues)
MSRPAHRRPEYHKINKDLFVLTYGALVAQLCKDYEKDEDVNQYLDKMGYGIGTRLVEDFL
ARSCVGRCHSYSEIIDIIAQVAFKMYLGITPSVTCNNSSKNEFSLILEKNPLVEFVEELP
AGRSSLCYCNLLCGIIRGALEMVHLAADVTFLQDRLKGDSVTEIGITFLKKRDEKKYRGK
K

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T215	1.000	1.000	2.771E-35	181	1.000	1.000	Q5T215.pdb.gz	TPC3L_HUMAN Trafficking protein particle complex subunit 3-like protein OS=Homo sapiens OX=9606 GN=TRAPPC3L PE=1 SV=1
2	AFDB:A0A087WWM0	0.905	0.872	1.232E-22	188	0.613	0.590	A0A087WWM0.pdb.gz	A0A087WWM0_HUMAN Trafficking protein particle complex subunit OS=Homo sapiens OX=9606 GN=TRAPPC3 PE=1 SV=1
3	PDB:1wc8A	0.847	0.937	1.450E-20	163	0.575	0.638	1wc8A.pdb.gz
4	AFDB:Q8I1Q2	0.859	0.833	2.814E-20	187	0.453	0.439	Q8I1Q2.pdb.gz	Q8I1Q2_PLAF7 Trafficking protein particle complex subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0418500 PE=3 SV=1
5	AFDB:Q9VSY8	0.866	0.880	1.072E-18	178	0.464	0.472	Q9VSY8.pdb.gz	Q9VSY8_DROME Trafficking protein particle complex subunit OS=Drosophila melanogaster OX=7227 GN=Bet3 PE=1 SV=3
6	AFDB:P36149	0.863	0.811	1.534E-18	193	0.448	0.420	P36149.pdb.gz	BET3_YEAST Trafficking protein particle complex subunit BET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BET3 PE=1 SV=1
7	AFDB:Q9P6P5	0.858	0.849	3.755E-18	183	0.453	0.448	Q9P6P5.pdb.gz	BET3_SCHPO Transport protein particle subunit bet3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bet3 PE=3 SV=1
8	AFDB:Q5ARJ4	0.863	0.832	4.231E-18	188	0.436	0.420	Q5ARJ4.pdb.gz	Q5ARJ4_EMENI Trafficking protein particle complex subunit BET3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09086 PE=3 SV=1
9	AFDB:F4K1U5	0.838	0.764	1.669E-17	199	0.464	0.422	F4K1U5.pdb.gz	F4K1U5_ARATH Trafficking protein particle complex subunit OS=Arabidopsis thaliana OX=3702 GN=TRAPPC3 PE=1 SV=1
10	AFDB:Q57UH5	0.845	0.795	1.928E-16	193	0.381	0.358	Q57UH5.pdb.gz	Q57UH5_TRYB2 Trafficking protein particle complex subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.5H5.860 PE=3 SV=1
11	PDB:3cueE	0.844	0.814	3.479E-16	188	0.448	0.431	3cueE.pdb.gz
12	PDB:7b6dG	0.818	0.874	5.608E-16	169	0.425	0.456	7b6dG.pdb.gz
13	AFDB:P34605	0.822	0.822	3.383E-15	181	0.387	0.387	P34605.pdb.gz	TPPC3_CAEEL Trafficking protein particle complex subunit 3 homolog OS=Caenorhabditis elegans OX=6239 GN=trpp-3 PE=1 SV=1
14	PDB:7b6dF	0.718	0.786	1.039E-7	164	0.133	0.146	7b6dF.pdb.gz
15	PDB:7u05J	0.734	0.639	1.319E-7	210	0.171	0.148	7u05J.pdb.gz
16	PDB:2j3tB	0.647	0.757	1.888E-7	152	0.155	0.184	2j3tB.pdb.gz
17	PDB:2cfhD	0.672	0.791	3.428E-7	151	0.166	0.199	2cfhD.pdb.gz
18	PDB:7u06E	0.602	0.525	2.838E-5	212	0.193	0.165	7u06E.pdb.gz
19	PDB:6jt0B	0.395	0.157	2.494E-3	576	0.127	0.040	6jt0B.pdb.gz	Structural insights into the mechanism of human soluble guanylate cyclase.
20	PDB:3a8eC	0.458	0.509	4.020E-3	159	0.144	0.164	3a8eC.pdb.gz	Structure of bacterial cellulose synthase subunit D octamer with four inner passageways

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T215	2.12e-134	375	181	1.000	1.000	TPC3L_HUMAN Trafficking protein particle complex subunit 3-like protein OS=Homo sapiens OX=9606 GN=TRAPPC3L PE=1 SV=1
2	O43617	2.62e-78	233	180	0.619	0.622	TPPC3_HUMAN Trafficking protein particle complex subunit 3 OS=Homo sapiens OX=9606 GN=TRAPPC3 PE=1 SV=1
3	O55013	4.89e-78	232	180	0.613	0.617	TPPC3_MOUSE Trafficking protein particle complex subunit 3 OS=Mus musculus OX=10090 GN=Trappc3 PE=1 SV=1
4	A0A087WWM0	1.80e-74	223	188	0.613	0.590	A0A087WWM0_HUMAN Trafficking protein particle complex subunit OS=Homo sapiens OX=9606 GN=TRAPPC3 PE=1 SV=1
5	Q8I1Q2	9.51e-54	171	187	0.459	0.444	Q8I1Q2_PLAF7 Trafficking protein particle complex subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0418500 PE=3 SV=1
6	P36149	1.42e-52	168	193	0.442	0.415	BET3_YEAST Trafficking protein particle complex subunit BET3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BET3 PE=1 SV=1
7	Q9VSY8	1.47e-52	167	178	0.459	0.466	Q9VSY8_DROME Trafficking protein particle complex subunit OS=Drosophila melanogaster OX=7227 GN=Bet3 PE=1 SV=3
8	Q5ARJ4	1.99e-52	167	188	0.436	0.420	Q5ARJ4_EMENI Trafficking protein particle complex subunit BET3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_09086 PE=3 SV=1
9	Q9P6P5	3.71e-50	161	183	0.459	0.454	BET3_SCHPO Transport protein particle subunit bet3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bet3 PE=3 SV=1
10	F4K1U5	9.80e-48	156	199	0.459	0.417	F4K1U5_ARATH Trafficking protein particle complex subunit OS=Arabidopsis thaliana OX=3702 GN=TRAPPC3 PE=1 SV=1
11	Q57UH5	1.06e-38	132	193	0.392	0.368	Q57UH5_TRYB2 Trafficking protein particle complex subunit OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.5H5.860 PE=3 SV=1
12	A0A087WYS5	2.66e-35	121	114	0.326	0.518	A0A087WYS5_HUMAN Trafficking protein particle complex subunit 3 OS=Homo sapiens OX=9606 GN=TRAPPC3 PE=1 SV=1
13	P34605	8.87e-34	119	181	0.343	0.343	TPPC3_CAEEL Trafficking protein particle complex subunit 3 homolog OS=Caenorhabditis elegans OX=6239 GN=trpp-3 PE=1 SV=1
14	A0A1D8PU84	0.010	37.7	248	0.210	0.153	A0A1D8PU84_CANAL Trafficking protein particle complex subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR10390WA PE=3 SV=1
15	Q86SZ2	0.017	36.6	158	0.177	0.203	TPC6B_HUMAN Trafficking protein particle complex subunit 6B OS=Homo sapiens OX=9606 GN=TRAPPC6B PE=1 SV=1
16	Q9P7N9	0.020	37.0	209	0.171	0.148	TRS31_SCHPO Transport protein particle subunit trs31 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trs31 PE=3 SV=1
17	Q7K2Q8	0.12	34.3	194	0.122	0.113	Q7K2Q8_DROME Trafficking protein particle complex subunit 5 OS=Drosophila melanogaster OX=7227 GN=Trs31 PE=1 SV=1
18	C8V0H5	0.35	33.1	187	0.193	0.187	C8V0H5_EMENI Transport protein particle (TRAPP) complex subunit TRS33, putative (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10826 PE=3 SV=1
19	Q38DI4	0.49	32.7	202	0.160	0.144	Q38DI4_TRYB2 Transport protein particle (TRAPP) subunit, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3210 PE=3 SV=1
20	Q9FGU1	0.58	32.3	195	0.160	0.149	Q9FGU1_ARATH Trafficking protein particle complex subunit OS=Arabidopsis thaliana OX=3702 GN=TRAPPC5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04051 TRAPP	1.4e-29	114.2	Transport protein particle (TRAPP) component

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000357591

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000283351	0.995	Trafficking protein particle complex subunit 8
2	9606.ENSP00000436005	0.995	Trafficking protein particle complex subunit 4
3	9606.ENSP00000470262	0.994	Trafficking protein particle complex subunit 5
4	9606.ENSP00000373979	0.993	Trafficking protein particle complex subunit 9
5	9606.ENSP00000291574	0.990	Trafficking protein particle complex subunit 10
6	9606.ENSP00000392495	0.987	Trafficking protein particle complex subunit 2
7	9606.ENSP00000301021	0.978	Trafficking protein particle complex subunit 2-like protein
8	9606.ENSP00000324318	0.975	Trafficking protein particle complex subunit 12
9	9606.ENSP00000302783	0.972	Trafficking protein particle complex subunit 1
10	9606.ENSP00000330289	0.962	Trafficking protein particle complex subunit 6B
11	9606.ENSP00000006275	0.956	Trafficking protein particle complex subunit 6A
12	9606.ENSP00000469888	0.938	Trafficking protein particle complex 2 pseudogene 1
13	9606.ENSP00000480332	0.902	Trafficking protein particle complex subunit 3
14	9606.ENSP00000335371	0.853	Trafficking protein particle complex subunit 11
15	9606.ENSP00000485615	0.795	TMEM1 protein
16	9606.ENSP00000308926	0.585	Belongs to the PP2C family
17	9606.ENSP00000387286	0.578	Ras-related protein Rab-1A
18	9606.ENSP00000355613	0.576	Tripartite motif-containing protein 67
19	9606.ENSP00000483333	0.554	SKI family transcriptional corepressor 2
20	9606.ENSP00000462435	0.547	Tubulin polymerization-promoting protein family member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.996	transport
GO:0009987	0.987	cellular process
GO:0016192	0.966	vesicle-mediated transport
GO:0051641	0.949	cellular localization
GO:0006888	0.942	endoplasmic reticulum to Golgi vesicle-mediated transport
GO:0065007	0.342	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032991	0.997	protein-containing complex
GO:0140535	0.992	intracellular protein-containing complex
GO:0110165	0.988	cellular anatomical entity
GO:0099023	0.988	vesicle tethering complex
GO:0030008	0.981	TRAPP complex
GO:0005737	0.977	cytoplasm
GO:0043226	0.976	organelle
GO:0012505	0.972	endomembrane system
GO:0043227	0.970	membrane-bounded organelle
GO:0005829	0.951	cytosol
GO:0043231	0.930	intracellular membrane-bounded organelle
GO:0005794	0.718	Golgi apparatus
GO:0016020	0.577	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]