StarFunc result for job id Q5T230

User Input

>input (341 residues)
MLLRPRRPPPLAPPAPPSPASPDPEPRTPGDAPGTPPRRPASPSALGELGLPVSPGSAQR
TPWSARETELLLGTLLQPAVWRALLLDRRQALPTYRRVSAALAQQQVRRTPAQCRRRYKF
LKDKFREAHGQPPGPFDEQIRKLMGLLGDNGRKRPRRRSPGSGRPQRARRPVPNAHAPAP
SEPDATPLPTARDRDADPTWTLRFSPSPPKSADASPAPGSPPAPAPTALATCIPEDRAPV
RGPGSPPPPPAREDPDSPPGRPEDCAPPPAAPPSLNTALLQTLGHLGDIANILGPLRDQL
LTLNQHVEQLRGAFDQTVSLAVGFILGSAAAERGVLRDPCQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T230	0.999	0.999	4.229E-48	341	1.000	1.000	Q5T230.pdb.gz	UTF1_HUMAN Undifferentiated embryonic cell transcription factor 1 OS=Homo sapiens OX=9606 GN=UTF1 PE=1 SV=1
2	AFDB:Q6J1H4	0.353	0.354	1.691E-26	339	0.633	0.637	Q6J1H4.pdb.gz	UTF1_MOUSE Undifferentiated embryonic cell transcription factor 1 OS=Mus musculus OX=10090 GN=Utf1 PE=1 SV=2
3	AFDB:A0A0A0MPG9	0.203	0.070	1.190E-5	1042	0.158	0.052	A0A0A0MPG9.pdb.gz
4	AFDB:O80512	0.170	0.157	1.287E-4	372	0.191	0.175	O80512.pdb.gz	O80512_ARATH Alcohol dehydrogenase transcription factor Myb/SANT-like family protein OS=Arabidopsis thaliana OX=3702 GN=At2g44730 PE=1 SV=1
5	AFDB:Q9LRX5	0.196	0.213	9.459E-4	310	0.158	0.174	Q9LRX5.pdb.gz	Q9LRX5_ARATH Homeodomain-like superfamily protein OS=Arabidopsis thaliana OX=3702 GN=AST1 PE=1 SV=1
6	AFDB:Q9SYG2	0.176	0.158	2.483E-3	383	0.176	0.157	Q9SYG2.pdb.gz	ASIL1_ARATH Trihelix transcription factor ASIL1 OS=Arabidopsis thaliana OX=3702 GN=ASIL1 PE=1 SV=1
7	AFDB:P21705	0.164	0.209	4.726E-3	255	0.167	0.224	P21705.pdb.gz	DAL82_YEAST Protein DAL82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DAL82 PE=1 SV=2
8	AFDB:Q9FX53	0.192	0.163	6.520E-3	406	0.091	0.076	Q9FX53.pdb.gz	TGT1_ARATH Trihelix transcription factor GT-1 OS=Arabidopsis thaliana OX=3702 GN=GT-1 PE=1 SV=1
9	AFDB:Q8IWY8	0.197	0.081	1.947E-2	852	0.147	0.059	Q8IWY8.pdb.gz	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
10	AFDB:Q8VZ20	0.183	0.197	2.361E-2	314	0.161	0.175	Q8VZ20.pdb.gz	ASR3_ARATH Trihelix transcription factor ASR3 OS=Arabidopsis thaliana OX=3702 GN=ASR3 PE=1 SV=1
11	PDB:5yzgL	0.133	0.110	1.178	419	0.073	0.060	5yzgL.pdb.gz	Structure of a human catalytic step I spliceosome
12	PDB:2hi3A	0.145	0.540	1.626	73	0.038	0.178	2hi3A.pdb.gz
13	PDB:3qouA	0.094	0.107	2.720	282	0.032	0.039	3qouA.pdb.gz	Escherichia coli Thioredoxin-like Protein YbbN Contains an Atypical Tetratricopeptide Repeat Motif and Is a Negative Regulator of GroEL.
14	PDB:6qdvO	0.140	0.110	2.901	441	0.076	0.059	6qdvO.pdb.gz	A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.
15	PDB:7pikC	0.136	0.087	3.299	557	0.050	0.031	7pikC.pdb.gz	Structural basis of transposon end recognition explains central features of Tn7 transposition systems.
16	PDB:6id0L	0.136	0.099	4.268	475	0.109	0.078	6id0L.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
17	PDB:5z56L	0.138	0.137	5.520	342	0.067	0.067	5z56L.pdb.gz	Structure of the human activated spliceosome in three conformational states.
18	PDB:2ofpB	0.137	0.156	6.696	294	0.041	0.048	2ofpB.pdb.gz	Crystal Structure of Escherichia coli Ketopantoate Reductase in a Ternary Complex with NADP+ and Pantoate Bound: SUBSTRATE RECOGNITION, CONFORMATIONAL CHANGE, AND COOPERATIVITY.
19	PDB:5jheA	0.085	0.079	6.696	388	0.047	0.041	5jheA.pdb.gz
20	PDB:8escS	0.090	0.106	6.696	268	0.044	0.056	8escS.pdb.gz	Structure and flexibility of the yeast NuA4 histone acetyltransferase complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T230	0.0	647	341	1.000	1.000	UTF1_HUMAN Undifferentiated embryonic cell transcription factor 1 OS=Homo sapiens OX=9606 GN=UTF1 PE=1 SV=1
2	Q6J1H4	3.98e-113	333	339	0.636	0.640	UTF1_MOUSE Undifferentiated embryonic cell transcription factor 1 OS=Mus musculus OX=10090 GN=Utf1 PE=1 SV=2
3	Q9NX65	8.57e-04	43.5	697	0.085	0.042	ZSC32_HUMAN Zinc finger and SCAN domain-containing protein 32 OS=Homo sapiens OX=9606 GN=ZSCAN32 PE=1 SV=3
4	A2ASS6	0.003	42.4	35213	0.120	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1
5	A0A8I5ZUN3	0.004	41.6	35375	0.106	0.001	A0A8I5ZUN3_RAT Titin OS=Rattus norvegicus OX=10116 GN=Ttn PE=1 SV=1
6	Q8IWY8	0.006	40.8	852	0.088	0.035	ZSC29_HUMAN Zinc finger and SCAN domain-containing protein 29 OS=Homo sapiens OX=9606 GN=ZSCAN29 PE=1 SV=2
7	Q8WVT3	0.030	38.5	735	0.103	0.048	TPC12_HUMAN Trafficking protein particle complex subunit 12 OS=Homo sapiens OX=9606 GN=TRAPPC12 PE=1 SV=3
8	Q8WZ42	0.95	34.3	34350	0.073	0.001	TITIN_HUMAN Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4
9	O01761	2.2	32.7	8081	0.141	0.006	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13837 Myb_DNA-bind_4	0.00016	33.3	Myb/SANT-like DNA-binding domain
2	PF13921 Myb_DNA-bind_6	43	15.8	Myb-like DNA-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000305906

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000375942	0.762	TATA-box-binding protein
2	9606.ENSP00000229307	0.748	Homeobox protein NANOG
3	9606.ENSP00000334952	0.746	Adhesion G protein-coupled receptor A3
4	9606.ENSP00000259915	0.743	POU domain, class 5, transcription factor 1
5	9606.ENSP00000422488	0.728	Steroid hormone receptor ERR2
6	9606.ENSP00000217086	0.718	Sal-like protein 4
7	9606.ENSP00000323588	0.716	Transcription factor SOX-2
8	9606.ENSP00000363314	0.712	Protein lin-28 homolog A
9	9606.ENSP00000359396	0.700	Developmental pluripotency-associated 5 protein
10	9606.ENSP00000317686	0.699	Zinc finger protein 42 homolog
11	9606.ENSP00000363804	0.690	Krueppel-like factor 4
12	9606.ENSP00000168712	0.687	Fibroblast growth factor 4
13	9606.ENSP00000331745	0.682	Growth/differentiation factor 3
14	9606.ENSP00000335306	0.679	Developmental pluripotency-associated protein 4
15	9606.ENSP00000417710	0.679	Developmental pluripotency-associated protein 2
16	9606.ENSP00000393154	0.669	F-box only protein 15
17	9606.ENSP00000357556	0.657	Homeobox protein VENTX
18	9606.ENSP00000296145	0.656	Teratocarcinoma-derived growth factor 1
19	9606.ENSP00000272134	0.595	Left-right determination factor 1
20	9606.ENSP00000302770	0.593	Zinc finger protein 296

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003713	1.000	transcription coactivator activity
GO:0003676	0.535	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0060255	0.985	regulation of macromolecule metabolic process
GO:0048522	0.983	positive regulation of cellular process
GO:0010468	0.981	regulation of gene expression
GO:0010556	0.979	regulation of macromolecule biosynthetic process
GO:0031326	0.979	regulation of cellular biosynthetic process
GO:0051252	0.979	regulation of RNA metabolic process
GO:0010604	0.978	positive regulation of macromolecule metabolic process
GO:0051173	0.977	positive regulation of nitrogen compound metabolic process
GO:0032502	0.973	developmental process
GO:0031325	0.965	positive regulation of cellular metabolic process
GO:0006355	0.965	regulation of DNA-templated transcription
GO:0032501	0.962	multicellular organismal process
GO:0048856	0.961	anatomical structure development
GO:0045935	0.913	positive regulation of nucleobase-containing compound metabolic process
GO:0010557	0.911	positive regulation of macromolecule biosynthetic process
GO:0031328	0.910	positive regulation of cellular biosynthetic process
GO:0006357	0.910	regulation of transcription by RNA polymerase II
GO:0007275	0.906	multicellular organism development
GO:0045944	0.899	positive regulation of transcription by RNA polymerase II
GO:0048513	0.891	animal organ development
GO:0048731	0.883	system development
GO:0022414	0.559	reproductive process
GO:0007548	0.499	sex differentiation
GO:0046661	0.397	male sex differentiation
GO:0008406	0.386	gonad development
GO:0008584	0.373	male gonad development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0043233	0.956	organelle lumen
GO:0070013	0.954	intracellular organelle lumen
GO:0031981	0.938	nuclear lumen
GO:0005654	0.911	nucleoplasm
GO:0005737	0.723	cytoplasm
GO:0012505	0.365	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]