StarFunc result for job id Q5T2D3

User Input

>input (398 residues)
MSRKQAAKSRPGSGSRKAEAERKRDERAARRALAKERRNRPESGGGGGCEEEFVSFANQL
QALGLKLREVPGDGNCLFRALGDQLEGHSRNHLKHRQETVDYMIKQREDFEPFVEDDIPF
EKHVASLAKPGTFAGNDAIVAFARNHQLNVVIHQLNAPLWQIRGTEKSSVRELHIAYRYG
EHYDSVRRINDNSEAPAHLQTDFQMLHQDESNKREKIKTKGMDSEDDLRDEVEDAVQKVC
NATGCSDFNLIVQNLEAENYNIESAIIAVLRMNQGKRNNAEENLEPSGRVLKQCGPLWEE
GGSGARIFGNQGLNEGRTENNKAQASPSEENKANKNQLAKVTNKQRREQQWMEKKKRQEE
RHRHKALESRGSHRDNNRSEAEANTQVTLVKTFAALNI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T2D3	1.000	1.000	6.194E-69	398	1.000	1.000	Q5T2D3.pdb.gz	OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens OX=9606 GN=OTUD3 PE=1 SV=1
2	AFDB:B1AZ99	0.690	0.693	4.551E-55	396	0.834	0.838	B1AZ99.pdb.gz	OTUD3_MOUSE OTU domain-containing protein 3 OS=Mus musculus OX=10090 GN=Otud3 PE=1 SV=1
3	AFDB:Q9VTK7	0.319	0.195	4.862E-11	659	0.158	0.096	Q9VTK7.pdb.gz	Q9VTK7_DROME Deubiquitinating enzyme A, isoform E OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
4	AFDB:Q96G74	0.342	0.241	3.202E-10	571	0.158	0.110	Q96G74.pdb.gz	OTUD5_HUMAN OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1
5	AFDB:Q57W52	0.309	0.142	5.413E-9	915	0.136	0.059	Q57W52.pdb.gz	Q57W52_TRYB2 OTU domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.190 PE=4 SV=1
6	PDB:4dhjA	0.301	0.467	1.917E-5	248	0.085	0.137	4dhjA.pdb.gz
7	PDB:4fjvA	0.291	0.478	1.420E-4	231	0.068	0.117	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
8	PDB:4ddgA	0.285	0.284	1.116E-3	399	0.095	0.095	4ddgA.pdb.gz
9	AFDB:Q5T6F2	0.111	0.043	5.537E-2	1119	0.083	0.029	Q5T6F2.pdb.gz	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
10	AFDB:H2L056	0.125	0.084	9.980E-2	613	0.075	0.049	H2L056.pdb.gz	UBXN3_CAEEL UBX domain-containing protein 3 OS=Caenorhabditis elegans OX=6239 GN=ubxn-3 PE=1 SV=1
11	AFDB:A4FVR1	0.111	0.078	1.263E-1	575	0.053	0.037	A4FVR1.pdb.gz	GIP1L_ARATH GBF-interacting protein 1-like OS=Arabidopsis thaliana OX=3702 GN=GIP1L PE=1 SV=1
12	AFDB:Q9VHN9	0.090	0.053	1.908E-1	826	0.090	0.044	Q9VHN9.pdb.gz	HPS5_DROME BLOC-2 complex member HPS5 homolog OS=Drosophila melanogaster OX=7227 GN=p PE=2 SV=1
13	AFDB:G5EGN3	0.087	0.094	2.277E-1	367	0.075	0.082	G5EGN3.pdb.gz	ELT6_CAEEL Transcription factor elt-6 OS=Caenorhabditis elegans OX=6239 GN=elt-6 PE=1 SV=1
14	PDB:5v3hA	0.124	0.117	5.421E-1	438	0.073	0.066	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
15	PDB:4xb6C	0.113	0.126	5.750E-1	353	0.028	0.031	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
16	PDB:3j6bL	0.105	0.134	1.166	229	0.050	0.087	3j6bL.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
17	PDB:4pdxA	0.071	0.049	2.507	622	0.018	0.011	4pdxA.pdb.gz
18	PDB:3e46A	0.104	0.188	2.821	202	0.058	0.114	3e46A.pdb.gz
19	PDB:3slcA	0.060	0.060	2.821	401	0.048	0.047	3slcA.pdb.gz
20	PDB:7mscQ	0.102	0.236	2.992	124	0.038	0.121	7mscQ.pdb.gz	Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B1AZ99	0.0	671	396	0.834	0.838	OTUD3_MOUSE OTU domain-containing protein 3 OS=Mus musculus OX=10090 GN=Otud3 PE=1 SV=1
2	Q5T2D3	0.0	822	398	1.000	1.000	OTUD3_HUMAN OTU domain-containing protein 3 OS=Homo sapiens OX=9606 GN=OTUD3 PE=1 SV=1
3	Q01804	8.13e-12	69.3	1114	0.146	0.052	OTUD4_HUMAN OTU domain-containing protein 4 OS=Homo sapiens OX=9606 GN=OTUD4 PE=1 SV=4
4	B2RRE7	7.88e-11	66.2	1107	0.113	0.041	OTUD4_MOUSE OTU domain-containing protein 4 OS=Mus musculus OX=10090 GN=Otud4 PE=1 SV=1
5	Q9XIP2	1.23e-10	65.5	505	0.101	0.079	OTU6_ARATH OVARIAN TUMOR DOMAIN-containing deubiquitinating enzyme 6 OS=Arabidopsis thaliana OX=3702 GN=OTU6 PE=1 SV=2
6	Q8N6M0	4.16e-10	62.4	293	0.126	0.171	OTU6B_HUMAN Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B PE=1 SV=1
7	Q9UUK3	2.86e-09	60.5	324	0.101	0.123	OTU2_SCHPO Ubiquitin thioesterase otu2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=otu2 PE=4 SV=1
8	Q9NP73	4.43e-09	60.8	1137	0.113	0.040	ALG13_HUMAN Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Homo sapiens OX=9606 GN=ALG13 PE=1 SV=2
9	Q9D8C3	7.68e-09	60.1	1166	0.113	0.039	ALG13_MOUSE Putative bifunctional UDP-N-acetylglucosamine transferase and deubiquitinase ALG13 OS=Mus musculus OX=10090 GN=Alg13 PE=1 SV=2
10	A0A0R4IPL2	1.92e-08	58.9	854	0.088	0.041	A0A0R4IPL2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=2
11	Q49HH8	2.42e-08	58.5	859	0.088	0.041	Q49HH8_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=2 SV=1
12	E9QIU2	2.46e-08	58.5	889	0.088	0.039	E9QIU2_DANRE ubiquitinyl hydrolase 1 OS=Danio rerio OX=7955 GN=otul PE=4 SV=1
13	Q5VV17	9.40e-08	56.2	481	0.090	0.075	OTUD1_HUMAN OTU domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OTUD1 PE=1 SV=1
14	Q3U2S4	3.04e-07	54.7	566	0.106	0.074	OTUD5_MOUSE OTU domain-containing protein 5 OS=Mus musculus OX=10090 GN=Otud5 PE=1 SV=2
15	Q7L8S5	3.21e-07	53.9	288	0.113	0.156	OTU6A_HUMAN OTU domain-containing protein 6A OS=Homo sapiens OX=9606 GN=OTUD6A PE=1 SV=1
16	Q8IQF9	3.50e-07	54.3	499	0.093	0.074	Q8IQF9_DROME AT23158p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
17	Q9VTK7	4.40e-07	54.3	659	0.093	0.056	Q9VTK7_DROME Deubiquitinating enzyme A, isoform E OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=2
18	Q95S49	5.54e-07	53.9	568	0.093	0.065	Q95S49_DROME GM08907p OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
19	E1JIE7	5.84e-07	53.9	568	0.093	0.065	E1JIE7_DROME Deubiquitinating enzyme A, isoform G OS=Drosophila melanogaster OX=7227 GN=Duba PE=2 SV=1
20	Q96G74	8.32e-07	53.5	571	0.106	0.074	OTUD5_HUMAN OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02338 OTU	1.5e-06	40.2	OTU-like cysteine protease
2	PF10275 Peptidase_C65	30	15.5	Peptidase C65 Otubain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364261

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000441543	0.971	Polyubiquitin-C
2	9606.ENSP00000361021	0.944	Phosphatase and tensin homolog
3	9606.ENSP00000272317	0.901	Ubiquitin-40S ribosomal protein S27a
4	9606.ENSP00000304697	0.900	Polyubiquitin-B
5	9606.ENSP00000388107	0.900	Ubiquitin-60S ribosomal protein L40
6	9606.ENSP00000409279	0.812	OTU domain-containing protein 4
7	9606.ENSP00000326813	0.738	Ubiquitin thioesterase OTU1
8	9606.ENSP00000352676	0.719	Ubiquitin thioesterase ZRANB1
9	9606.ENSP00000387882	0.705	Synaptotagmin like tandem C2 proteins
10	9606.ENSP00000305926	0.699	OTU domain-containing protein 7A
11	9606.ENSP00000284274	0.698	Ubiquitin thioesterase otulin
12	9606.ENSP00000444357	0.681	Ubiquitin thioesterase OTUB1
13	9606.ENSP00000462729	0.673	OTU domain-containing protein 7B
14	9606.ENSP00000203664	0.672	Ubiquitin thioesterase OTUB2
15	9606.ENSP00000252809	0.647	Growth differentiation factor 15
16	9606.ENSP00000364257	0.627	Group IIE secretory phospholipase A2
17	9606.ENSP00000296695	0.620	Serine protease inhibitor Kazal-type 1
18	9606.ENSP00000358474	0.617	Lys-63-specific deubiquitinase BRCC36
19	9606.ENSP00000362650	0.611	Protein SCAI
20	9606.ENSP00000364263	0.603	E3 ubiquitin protein ligase that is part of an apoptotic signaling pathway activated by endoplasmic reticulum stress . In that process, stimulates the expression of proteins specific of the unfolded protein response (UPR), ubiquitinates BNIP1 and regulates its localization to the mitochondrion and induces calcium release from the endoplasmic reticulum that ultimately leads to cell apoptosis

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	0.999	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.998	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0043170	0.996	macromolecule metabolic process
GO:0070647	0.991	protein modification by small protein conjugation or removal
GO:0006508	0.988	proteolysis
GO:0050794	0.987	regulation of cellular process
GO:0009966	0.981	regulation of signal transduction
GO:0016579	0.981	protein deubiquitination
GO:0048519	0.969	negative regulation of biological process
GO:0031647	0.969	regulation of protein stability
GO:0009968	0.949	negative regulation of signal transduction
GO:1902531	0.930	regulation of intracellular signal transduction
GO:0050821	0.926	protein stabilization
GO:0051896	0.913	regulation of protein kinase B signaling
GO:1902532	0.907	negative regulation of intracellular signal transduction
GO:0051898	0.850	negative regulation of protein kinase B signaling
GO:0071108	0.372	protein K48-linked deubiquitination
GO:0035871	0.309	protein K11-linked deubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.458	intracellular membrane-bounded organelle
GO:0005634	0.415	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	0.999	ubiquitinyl hydrolase 1.

[back to server]