StarFunc result for job id Q5T2Q4

User Input

>input (361 residues)
MGNILTCCVCPRASPGLHQHQGLVCHCESEIYEAAAGDLIAGVPVAAAVEPGEVTFVAGE
GLHMHHICEREMPEDIPLEPNPSDHPKASTIFLRKSQTDVQEKKKKQLCKVSTEHFTQQY
SSCSTIFLDDSIASQPHLTMTLKSCDLGTILSYQAKRDAHRSLGIFDEQLHPLTVRKEVL
EEYFKYDPEHKLIFRFVRTLFKAMRLTAEFAIVSLIYIERLVSYADIDICPTNWKRIVLG
AILLASKVWSDMAVWNEDYCKLFKNITVEEMNELERQFLKLINYNNSITNSVYSRFYFDL
RTLAHNNGLYSPVYLLDRERAWKLEAFSRMEQDKVFYSAAKNGSLSADDLIHLQRAKAIL
F

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3YUJ3	0.690	0.679	1.914E-30	367	0.576	0.567	D3YUJ3.pdb.gz	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
2	AFDB:E7F3H3	0.641	0.662	5.557E-27	349	0.479	0.496	E7F3H3.pdb.gz	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
3	AFDB:Q9VKF0	0.663	0.594	1.043E-24	406	0.416	0.369	Q9VKF0.pdb.gz	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
4	AFDB:P34624	0.644	0.651	1.084E-21	357	0.374	0.378	P34624.pdb.gz	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
5	AFDB:Q54ZC9	0.503	0.399	4.820E-14	463	0.244	0.190	Q54ZC9.pdb.gz	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
6	AFDB:P40186	0.388	0.481	2.144E-6	285	0.139	0.175	P40186.pdb.gz	PCL7_YEAST PHO85 cyclin-7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL7 PE=1 SV=3
7	AFDB:Q382C9	0.391	0.650	6.289E-6	211	0.114	0.194	Q382C9.pdb.gz	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
8	AFDB:Q75J86	0.347	0.164	3.659E-5	798	0.163	0.074	Q75J86.pdb.gz	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
9	AFDB:C8V078	0.298	0.439	4.450E-5	241	0.097	0.145	C8V078.pdb.gz	C8V078_EMENI Cyclin-dependent protein kinase complex component, putative (AFU_orthologue AFUA_2G07660) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_10741 PE=4 SV=1
10	AFDB:Q9FKF6	0.364	0.574	4.674E-5	219	0.105	0.174	Q9FKF6.pdb.gz	CCU43_ARATH Cyclin-U4-3 OS=Arabidopsis thaliana OX=3702 GN=CYCU4-3 PE=1 SV=1
11	PDB:2pk9D	0.347	0.544	3.499E-3	219	0.097	0.160	2pk9D.pdb.gz
12	PDB:2w96A	0.244	0.342	5.687E-2	249	0.066	0.096	2w96A.pdb.gz
13	PDB:1zp2A	0.237	0.353	9.740E-2	227	0.055	0.088	1zp2A.pdb.gz
14	PDB:7kueB	0.231	0.339	1.128E-1	225	0.102	0.164	7kueB.pdb.gz	Structure of TFIIK for phosphorylation of CTD of RNA polymerase II.
15	PDB:7nj0C	0.215	0.274	1.185E-1	270	0.091	0.122	7nj0C.pdb.gz	Structural basis of human separase regulation by securin and CDK1-cyclin B1.
16	PDB:1g3nC	0.253	0.376	2.591E-1	233	0.047	0.073	1g3nC.pdb.gz
17	PDB:6gzhB	0.190	0.252	5.139E-1	252	0.080	0.115	6gzhB.pdb.gz	Small Molecules Co-targeting CKI alpha and the Transcriptional Kinases CDK7/9 Control AML in Preclinical Models.
18	PDB:7kpvB	0.232	0.282	5.952E-1	290	0.072	0.090	7kpvB.pdb.gz
19	PDB:4p9uE	0.114	0.139	6.250E-1	272	0.058	0.077	4p9uE.pdb.gz	The 40-residue insertion in Vibrio cholerae FadR facilitates binding of an additional fatty acyl-CoA ligand.
20	PDB:3g33B	0.238	0.360	7.982E-1	229	0.058	0.092	3g33B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8N7R7	1.70e-142	410	359	0.596	0.599	CCYL1_HUMAN Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1 PE=1 SV=2
2	D3YUJ3	1.09e-127	372	367	0.529	0.520	D3YUJ3_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
3	E9Q226	5.83e-120	350	291	0.501	0.622	E9Q226_MOUSE Cyclin Y-like 1 OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
4	A0A286Y7Z8	8.81e-109	323	342	0.501	0.529	A0A286Y7Z8_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=2
5	Q8ND76	3.29e-108	322	341	0.499	0.528	CCNY_HUMAN Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY PE=1 SV=2
6	Q8BGU5	7.68e-108	321	341	0.507	0.537	CCNY_MOUSE Cyclin-Y OS=Mus musculus OX=10090 GN=Ccny PE=1 SV=1
7	E7F3H3	1.00e-106	318	349	0.496	0.513	E7F3H3_DANRE Cyclin Y OS=Danio rerio OX=7955 GN=ccny PE=3 SV=1
8	Q9VKF0	2.30e-88	273	406	0.404	0.360	Q9VKF0_DROME Cyclin Y, isoform A OS=Drosophila melanogaster OX=7227 GN=CycY PE=1 SV=1
9	P34624	5.85e-82	255	357	0.363	0.367	CCNY_CAEEL Cyclin-Y OS=Caenorhabditis elegans OX=6239 GN=cyy-1 PE=1 SV=3
10	Q54ZC9	5.11e-39	146	463	0.219	0.171	Q54ZC9_DICDI Cyclin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277667 PE=3 SV=1
11	A0A087WPI4	1.48e-24	97.8	85	0.139	0.588	A0A087WPI4_MOUSE Cyclin Y-like 1 (Fragment) OS=Mus musculus OX=10090 GN=Ccnyl1 PE=1 SV=1
12	Q75J86	1.92e-08	58.5	798	0.091	0.041	Q75J86_DICDI Cyclin-related 2 family protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0277391 PE=4 SV=1
13	Q6PGQ1	1.22e-04	45.1	229	0.091	0.144	DRIC1_HUMAN Aspartate-rich protein 1 OS=Homo sapiens OX=9606 GN=DRICH1 PE=1 SV=1
14	Q7K6A7	7.65e-04	42.7	229	0.072	0.114	Q7K6A7_PLAF7 Cyclin OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0518400 PE=3 SV=1
15	A0A1D8PNP1	0.003	41.6	373	0.075	0.072	A0A1D8PNP1_CANAL Pcl1p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=PCL1 PE=4 SV=1
16	Q12477	0.006	40.4	304	0.064	0.076	PCL9_YEAST PHO85 cyclin-9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PCL9 PE=1 SV=1
17	P20052	0.016	39.3	293	0.091	0.113	PHO80_YEAST PHO85 cyclin PHO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PHO80 PE=1 SV=3
18	Q382C9	0.019	38.5	211	0.078	0.133	Q382C9_TRYB2 Cyclin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5660 PE=3 SV=1
19	Q9NG22	0.019	38.5	211	0.078	0.133	Q9NG22_9TRYP Cyclin OS=Trypanosoma brucei OX=5691 GN=CYC2 PE=2 SV=1
20	O42979	0.084	36.6	243	0.066	0.099	PSL1_SCHPO PHO85 cyclin-like protein psl1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=psl1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08613 Cyclin	8.7e-09	47.4	Cyclin
2	PF00134 Cyclin_N	3.3e-07	41.5	Cyclin, N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9598.ENSPTRP00000045403

Rank	PPI partner	STRING score	Description
1	9598.ENSPTRP00000037496	0.686	Cyclin dependent kinase 16
2	9598.ENSPTRP00000033167	0.638	Uncharacterized protein
3	9598.ENSPTRP00000024023	0.538	Heat shock transcription factor 2 binding protein
4	9598.ENSPTRP00000009043	0.527	Cyclin-dependent kinase 17

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.998	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.962	regulation of biological process
GO:0009987	0.933	cellular process
GO:0050794	0.905	regulation of cellular process
GO:0007283	0.897	spermatogenesis
GO:0019222	0.790	regulation of metabolic process
GO:0051171	0.754	regulation of nitrogen compound metabolic process
GO:0060255	0.633	regulation of macromolecule metabolic process
GO:0080090	0.627	regulation of primary metabolic process
GO:0031323	0.574	regulation of cellular metabolic process
GO:0051726	0.497	regulation of cell cycle
GO:0060294	0.445	cilium movement involved in cell motility
GO:0097722	0.412	sperm motility
GO:0044772	0.346	mitotic cell cycle phase transition

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0005886	0.986	plasma membrane
GO:0005622	0.845	intracellular anatomical structure
GO:0032991	0.844	protein-containing complex
GO:0005737	0.826	cytoplasm
GO:0043231	0.824	intracellular membrane-bounded organelle
GO:0005634	0.761	nucleus
GO:0005829	0.580	cytosol
GO:1990234	0.552	transferase complex
GO:0000307	0.537	cyclin-dependent protein kinase holoenzyme complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]