StarFunc result for job id Q5T2R2

User Input

>input (415 residues)
MASRWWRWRRGCSWKPAARSPGPGSPGRAGPLGPSAAAEVRAQVHRRKGLDLSQIPYINL
VKHLTSACPNVCRISRFHHTTPDSKTHSGEKYTDPFKLGWRDLKGLYEDIRKELLISTSE
LKEMSEYYFDGKGKAFRPIIVALMARACNIHHNNSRHVQASQRAIALIAEMIHTASLVHD
DVIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISILTQVIEDLVR
GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHEIAYQYGKNVG
IAFQLIDDVLDFTSCSDQMGKPTSADLKLGLATGPVLFACQQFPEMNAMIMRRFSLPGDV
DRARQYVLQSDGVQQTTYLAQQYCHEAIREISKLRPSPERDALIQLSEIVLTRDK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T2R2	1.000	1.000	1.250E-54	415	1.000	1.000	Q5T2R2.pdb.gz	DPS1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS1 OS=Homo sapiens OX=9606 GN=PDSS1 PE=1 SV=1
2	AFDB:Q33DR2	0.811	0.823	1.273E-44	409	0.836	0.848	Q33DR2.pdb.gz	DPS1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS1 OS=Mus musculus OX=10090 GN=Pdss1 PE=1 SV=1
3	AFDB:Q9V9Z3	0.755	0.719	1.037E-28	436	0.460	0.438	Q9V9Z3.pdb.gz	Q9V9Z3_DROME FI02023p OS=Drosophila melanogaster OX=7227 GN=qless PE=2 SV=2
4	AFDB:P91093	0.740	0.780	1.025E-23	393	0.359	0.379	P91093.pdb.gz	P91093_CAEEL Decaprenyl-diphosphate synthase subunit 2 OS=Caenorhabditis elegans OX=6239 GN=coq-1 PE=1 SV=2
5	AFDB:O43091	0.739	0.810	5.938E-23	378	0.366	0.402	O43091.pdb.gz	DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
6	AFDB:Q653T6	0.733	0.709	7.319E-23	430	0.366	0.353	Q653T6.pdb.gz	SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SPS1 PE=1 SV=1
7	AFDB:Q5HZ00	0.729	0.717	5.011E-22	422	0.361	0.355	Q5HZ00.pdb.gz	SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SPS3 PE=1 SV=1
8	AFDB:P18900	0.731	0.644	5.924E-22	473	0.335	0.294	P18900.pdb.gz	COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ1 PE=1 SV=1
9	AFDB:Q8S948	0.735	0.751	3.431E-21	406	0.301	0.308	Q8S948.pdb.gz	SPS1_ARATH Solanesyl diphosphate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS1 PE=1 SV=1
10	AFDB:Q75HZ9	0.731	0.752	8.611E-21	403	0.292	0.300	Q75HZ9.pdb.gz	SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SPS2 PE=1 SV=2
11	PDB:3aqbD	0.687	0.868	6.806E-15	325	0.200	0.255	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
12	PDB:5ze6A	0.686	0.892	2.387E-14	315	0.227	0.298	5ze6A.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
13	PDB:4gp2A	0.666	0.798	6.497E-13	342	0.202	0.246	4gp2A.pdb.gz	Crystal Structure of Isoprenoid Synthase from Pyrobaculum Calidifontis
14	PDB:5zlfA	0.634	0.883	1.438E-12	293	0.222	0.314	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
15	PDB:1wmwA	0.629	0.779	1.068E-10	328	0.171	0.216	1wmwA.pdb.gz
16	PDB:3ipiA	0.541	0.817	3.905E-10	268	0.181	0.280	3ipiA.pdb.gz
17	PDB:3ts7B	0.540	0.734	3.032E-9	297	0.183	0.256	3ts7B.pdb.gz
18	PDB:1rqiA	0.554	0.747	1.063E-8	300	0.181	0.250	1rqiA.pdb.gz	Structural basis for bisphosphonate-mediated inhibition of isoprenoid biosynthesis
19	PDB:3ucaA	0.535	0.785	1.156E-8	274	0.169	0.255	3ucaA.pdb.gz
20	PDB:5zlfB	0.513	0.802	1.310E-8	259	0.186	0.297	5zlfB.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q33DR2	0.0	705	409	0.836	0.848	DPS1_MOUSE All trans-polyprenyl-diphosphate synthase PDSS1 OS=Mus musculus OX=10090 GN=Pdss1 PE=1 SV=1
2	Q5T2R2	0.0	865	415	1.000	1.000	DPS1_HUMAN All trans-polyprenyl-diphosphate synthase PDSS1 OS=Homo sapiens OX=9606 GN=PDSS1 PE=1 SV=1
3	Q9V9Z3	2.96e-127	376	436	0.434	0.413	Q9V9Z3_DROME FI02023p OS=Drosophila melanogaster OX=7227 GN=qless PE=2 SV=2
4	Q8SY08	3.92e-104	310	245	0.342	0.580	Q8SY08_DROME RE18374p OS=Drosophila melanogaster OX=7227 GN=qless PE=2 SV=1
5	P91093	5.01e-92	284	393	0.345	0.364	P91093_CAEEL Decaprenyl-diphosphate synthase subunit 2 OS=Caenorhabditis elegans OX=6239 GN=coq-1 PE=1 SV=2
6	O43091	4.54e-86	268	378	0.364	0.399	DPS1_SCHPO Decaprenyl-diphosphate synthase subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dps1 PE=1 SV=1
7	Q653T6	2.49e-84	266	430	0.393	0.379	SPS1_ORYSJ Solanesyl-diphosphate synthase 1, mitochondrial OS=Oryza sativa subsp. japonica OX=39947 GN=SPS1 PE=1 SV=1
8	Q5HZ00	5.26e-77	246	422	0.335	0.329	SPS3_ARATH Solanesyl diphosphate synthase 3, chloroplastic/mitochondrial OS=Arabidopsis thaliana OX=3702 GN=SPS3 PE=1 SV=1
9	Q8S948	8.99e-62	206	406	0.277	0.283	SPS1_ARATH Solanesyl diphosphate synthase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS1 PE=1 SV=1
10	P18900	2.92e-59	202	473	0.275	0.241	COQ1_YEAST Hexaprenyl pyrophosphate synthase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=COQ1 PE=1 SV=1
11	Q76FS5	3.66e-59	200	417	0.267	0.266	SPS2_ARATH Solanesyl diphosphate synthase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SPS2 PE=1 SV=1
12	Q38EX7	5.36e-59	198	359	0.301	0.348	Q38EX7_TRYB2 Farnesyl pyrophosphate synthetase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.4300 PE=3 SV=1
13	Q75HZ9	2.81e-56	192	403	0.265	0.273	SPS2_ORYSJ Solanesyl-diphosphate synthase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SPS2 PE=1 SV=2
14	P31114	4.19e-43	156	348	0.236	0.282	HEPS2_BACSU Heptaprenyl diphosphate synthase component 2 OS=Bacillus subtilis (strain 168) OX=224308 GN=hepT PE=1 SV=1
15	P55785	5.69e-43	155	320	0.248	0.322	HEPS2_GEOSE Heptaprenyl diphosphate synthase component 2 OS=Geobacillus stearothermophilus OX=1422 GN=hepT PE=3 SV=1
16	P0AD57	1.08e-42	154	323	0.239	0.307	ISPB_ECOLI Octaprenyl diphosphate synthase OS=Escherichia coli (strain K12) OX=83333 GN=ispB PE=1 SV=1
17	O96130	5.10e-34	135	538	0.178	0.138	O96130_PLAF7 Octaprenyl pyrophosphate synthase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0202700 PE=4 SV=1
18	O66129	1.85e-32	127	325	0.217	0.277	HEXB_MICLU Hexaprenyl-diphosphate synthase large subunit ((2E,6E)-farnesyl-diphosphate specific) OS=Micrococcus luteus OX=1270 GN=hexs-b PE=1 SV=1
19	A7IAG2	9.95e-27	111	325	0.202	0.258	A7IAG2_METB6 Farnesyltranstransferase OS=Methanoregula boonei (strain DSM 21154 / JCM 14090 / 6A8) OX=456442 GN=Mboo_2209 PE=3 SV=1
20	O06428	4.93e-24	103	335	0.234	0.290	NPPPS_MYCTU Nonaprenyl diphosphate synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=grcC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00348 polyprenyl_synt	2.2e-65	231.9	Polyprenyl synthetase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365388

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000310873	0.995	4-hydroxybenzoate polyprenyltransferase, mitochondrial
2	9606.ENSP00000288532	0.984	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
3	9606.ENSP00000262507	0.971	Ubiquinone biosynthesis protein COQ9, mitochondrial
4	9606.ENSP00000349078	0.971	Farnesyl pyrophosphate synthase
5	9606.ENSP00000282841	0.964	Geranylgeranyl pyrophosphate synthase
6	9606.ENSP00000353104	0.955	Dehydrodolichyl diphosphate synthase complex subunit DHDDS
7	9606.ENSP00000333946	0.950	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
8	9606.ENSP00000300452	0.946	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
9	9606.ENSP00000480828	0.944	Squalene synthase
10	9606.ENSP00000254759	0.942	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
11	9606.ENSP00000355741	0.941	Atypical kinase COQ8A, mitochondrial
12	9606.ENSP00000246166	0.937	Protein farnesyltransferase subunit beta
13	9606.ENSP00000315118	0.934	Atypical kinase COQ8B, mitochondrial
14	9606.ENSP00000322316	0.932	5-demethoxyubiquinone hydroxylase, mitochondrial
15	9606.ENSP00000366006	0.932	UbiA prenyltransferase domain-containing protein 1
16	9606.ENSP00000357480	0.923	Dehydrodolichyl diphosphate synthase complex subunit NUS1
17	9606.ENSP00000303423	0.909	Protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
18	9606.ENSP00000312618	0.904	Acyl-CoA dehydrogenase family member 9, mitochondrial
19	9606.ENSP00000358033	0.875	Decaprenyl-diphosphate synthase subunit 2
20	9606.ENSP00000426638	0.818	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004659	1.000	prenyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.999	primary metabolic process
GO:0044283	0.997	small molecule biosynthetic process
GO:0042180	0.995	cellular ketone metabolic process
GO:1901663	0.989	quinone biosynthetic process
GO:0006743	0.987	ubiquinone metabolic process
GO:0006629	0.985	lipid metabolic process
GO:0006720	0.979	isoprenoid metabolic process
GO:0006744	0.963	ubiquinone biosynthetic process
GO:0008610	0.957	lipid biosynthetic process
GO:0008299	0.947	isoprenoid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:1902494	0.998	catalytic complex
GO:0070013	0.996	intracellular organelle lumen
GO:1990234	0.952	transferase complex
GO:0005759	0.532	mitochondrial matrix
GO:0031981	0.440	nuclear lumen
GO:0016020	0.332	membrane
GO:0005654	0.323	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.5.1.-	1.000	Transferring alkyl or aryl groups, other than methyl groups.

[back to server]