StarFunc result for job id Q5T2S8

User Input

>input (1044 residues)
MGVALRKLTQWTAAGHGTGILEITPLNEAILKEIIVFVESFIYKHPQEAKFVFVEPLEWN
TSLAPSAFESGYVVSETTVKSEEVDKNGQPLLFLSVPQIKIRSFGQLSRLLLIAKTGKLK
EAQACVEANRDPIVKILGSDYNTMKENSIALNILGKITRDDDPESEIKMKIAMLLKQLDL
HLLNHSLKHISLEISLSPMTVKKDIELLKRFSGKGNQTVLESIEYTSDYEFSNGCRAPPW
RQIRGEICYVLVKPHDGETLCITCSAGGVFLNGGKTDDEGDVNYERKGSIYKNLVTFLRE
KSPKFSENMSKLGISFSEDQQKEKDQLGKAPKKEEAAALRKDISGSDKRSLEKNQINFWR
NQMTKRWEPSLNWKTTVNYKGKGSAKEIQEDKHTGKLEKPRPSVSHGRAQLLRKSAEKIE
ETVSDSSSESEEDEEPPDHRQEASADLPSEYWQIQKLVKYLKGGNQTATVIALCSMRDFS
LAQETCQLAIRDVGGLEVLINLLETDEVKCKIGSLKILKEISHNPQIRQNIVDLGGLPIM
VNILDSPHKSLKCLAAETIANVAKFKRARRVVRQHGGITKLVALLDCAHDSTKPAQSSLY
EARDVEVARCGALALWSCSKSHTNKEAIRKAGGIPLLARLLKTSHENMLIPVVGTLQECA
SEENYRAAIKAERIIENLVKNLNSENEQLQEHCAMAIYQCAEDKETRDLVRLHGGLKPLA
SLLNNTDNKERLAAVTGAIWKCSISKENVTKFREYKAIETLVGLLTDQPEEVLVNVVGAL
GECCQERENRVIVRKCGGIQPLVNLLVGINQALLVNVTKAVGACAVEPESMMIIDRLDGV
RLLWSLLKNPHPDVKASAAWALCPCIKNAKDAGEMVRSFVGGLELIVNLLKSDNKEVLAS
VCAAITNIAKDQENLAVITDHGVVPLLSKLANTNNNKLRHHLAEAISRCCMWGRNRVAFG
EHKAVAPLVRYLKSNDTNVHRATAQALYQLSEDADNCITMHENGAVKLLLDMVGSPDQDL
QEAAAGCISNIRRLALATEKARYT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B2RY50	0.627	0.631	0.000	1037	0.846	0.851	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
2	AFDB:E1B8W3	0.613	0.613	0.000	1044	0.859	0.859	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
3	AFDB:Q5T2S8	1.000	1.000	0.000	1044	1.000	1.000	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
4	AFDB:E7FB07	0.581	0.580	6.124E-88	1047	0.591	0.589	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
5	PDB:7rroH7	0.544	0.969	1.254E-55	580	0.534	0.962	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	AFDB:Q9VM21	0.561	0.863	8.265E-47	669	0.274	0.428	Q9VM21.pdb.gz	GUDU_DROME Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
7	AFDB:Q388H0	0.337	0.314	2.611E-24	1133	0.153	0.141	Q388H0.pdb.gz	Q388H0_TRYB2 Armadillo/beta-catenin-like repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2450 PE=4 SV=1
8	PDB:2z6gA	0.314	0.536	6.933E-17	550	0.110	0.209	2z6gA.pdb.gz
9	AFDB:P18824	0.331	0.392	7.825E-17	843	0.118	0.146	P18824.pdb.gz	ARM_DROME Armadillo segment polarity protein OS=Drosophila melanogaster OX=7227 GN=arm PE=1 SV=1
10	AFDB:Q9M224	0.363	0.405	1.969E-16	928	0.099	0.111	Q9M224.pdb.gz	ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana OX=3702 GN=At3g60350 PE=2 SV=1
11	AFDB:O93614	0.381	0.579	4.574E-16	607	0.081	0.140	O93614.pdb.gz	GDS1A_XENLA Rap1 GTPase-GDP dissociation stimulator 1-A OS=Xenopus laevis OX=8355 GN=rap1gds1-a PE=1 SV=1
12	AFDB:O43028	0.354	0.625	8.022E-16	550	0.102	0.193	O43028.pdb.gz	VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vac8 PE=1 SV=4
13	PDB:4r0zA	0.337	0.577	1.626E-14	557	0.101	0.189	4r0zA.pdb.gz
14	PDB:6kbnC	0.363	0.694	9.132E-14	504	0.090	0.187	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:3tpoA	0.307	0.668	4.926E-13	438	0.085	0.203	3tpoA.pdb.gz
16	PDB:1wa5B	0.296	0.584	2.264E-12	466	0.068	0.152	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
17	PDB:5tbkA	0.263	0.549	7.248E-12	417	0.080	0.199	5tbkA.pdb.gz
18	PDB:7nscE	0.444	0.711	1.271E-11	615	0.088	0.150	7nscE.pdb.gz
19	PDB:4tnmA	0.260	0.537	5.841E-11	407	0.072	0.184	4tnmA.pdb.gz
20	PDB:4jlqA	0.345	0.418	1.470E-10	840	0.091	0.113	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RY50	0.0	1744	1037	0.852	0.857	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
2	E1B8W3	0.0	1792	1044	0.863	0.863	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
3	E7FB07	0.0	1139	1047	0.596	0.594	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
4	Q5T2S8	0.0	2146	1044	1.000	1.000	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
5	Q9VM21	0.0	557	669	0.278	0.433	GUDU_DROME Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
6	Q388H0	2.61e-16	86.7	1133	0.125	0.116	Q388H0_TRYB2 Armadillo/beta-catenin-like repeat OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.2450 PE=4 SV=1
7	A2R3P5	4.35e-14	79.0	576	0.091	0.165	A2R3P5_ASPNC Vacuolar protein 8 OS=Aspergillus niger (strain ATCC MYA-4892 / CBS 513.88 / FGSC A1513) OX=425011 GN=An14g05020 PE=3 SV=1
8	P39968	4.33e-11	69.3	578	0.085	0.154	VAC8_YEAST Vacuolar protein 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VAC8 PE=1 SV=3
9	Q59MN0	1.91e-10	67.0	585	0.066	0.118	VAC8_CANAL Vacuolar protein 8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=VAC8 PE=3 SV=3
10	O43028	2.59e-09	63.5	550	0.102	0.195	VAC8_SCHPO Vacuolar protein 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vac8 PE=1 SV=4
11	A0A2R8Y7Z0	6.33e-09	62.4	780	0.063	0.085	A0A2R8Y7Z0_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
12	Q5W041	7.62e-09	62.4	872	0.090	0.108	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
13	F1QGH7	1.18e-08	61.6	780	0.063	0.085	CTNB1_DANRE Catenin beta-1 OS=Danio rerio OX=7955 GN=ctnnb1 PE=1 SV=1
14	O42486	1.31e-08	61.6	781	0.101	0.134	O42486_CHICK Beta catenin OS=Gallus gallus OX=9031 GN=Bcat PE=1 SV=1
15	B4DGU4	1.93e-08	60.8	774	0.063	0.085	B4DGU4_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
16	A0A1D5NYE8	1.98e-08	60.8	781	0.063	0.085	A0A1D5NYE8_CHICK Catenin beta 1 OS=Gallus gallus OX=9031 GN=CTNNB1 PE=1 SV=1
17	Q5R2I4	1.98e-08	60.8	781	0.063	0.085	Q5R2I4_PELSI Beta-catenin homologue OS=Pelodiscus sinensis OX=13735 GN=PsBeta-catenin PE=2 SV=1
18	B6V8E6	2.02e-08	60.8	781	0.063	0.085	CTNB1_CANLF Catenin beta-1 OS=Canis lupus familiaris OX=9615 GN=CTNNB1 PE=1 SV=1
19	Q0VCX4	2.02e-08	60.8	781	0.063	0.085	CTNB1_BOVIN Catenin beta-1 OS=Bos taurus OX=9913 GN=CTNNB1 PE=1 SV=1
20	P35222	2.11e-08	60.8	781	0.063	0.085	CTNB1_HUMAN Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	1.9e-05	35.1	Adaptin N terminal region
2	PF00514 Arm	1.7e-50	178.8	Armadillo/beta-catenin-like repeat
3	PF04826 Arm_2	1.2e-06	39.8	Armadillo-like
4	PF12717 Cnd1	0.00045	31.8	non-SMC mitotic condensation complex subunit 1
5	PF05303 GSKIP_dom	13	17.3	GSKIP domain
6	PF02985 HEAT	1e-05	36.3	HEAT repeat
7	PF13646 HEAT_2	4.5e-16	70.3	HEAT repeats
8	PF13513 HEAT_EZ	8.2e-10	50.3	HEAT-like repeat
9	PF05804 KAP	6.8e-05	32.9	Kinesin-associated protein (KAP)
10	PF14663 RasGEF_N_2	1.3	20.9	Rapamycin-insensitive companion of mTOR RasGEF_N domain
11	PF11701 UNC45-central	0.011	27.1	Myosin-binding striated muscle assembly central
12	PF11698 V-ATPase_H_C	0.0086	27.6	V-ATPase subunit H
13	PF03224 V-ATPase_H_N	7.4	17.4	V-ATPase subunit H
14	PF12755 Vac14_Fab1_bd	91	15.1	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000306410

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348757	0.913	Coiled-coil domain-containing protein 151
2	9606.ENSP00000318429	0.895	Coiled-coil domain-containing protein 114
3	9606.ENSP00000323275	0.835	Dynein assembly factor 4, axonemal
4	9606.ENSP00000231749	0.826	Zinc finger MYND domain-containing protein 10
5	9606.ENSP00000478589	0.824	Tetratricopeptide repeat protein 25
6	9606.ENSP00000297440	0.811	Dynein assembly factor 5, axonemal
7	9606.ENSP00000298292	0.809	Protein kintoun
8	9606.ENSP00000265104	0.808	Dynein heavy chain 5, axonemal
9	9606.ENSP00000484634	0.789	Protein tilB homolog
10	9606.ENSP00000405708	0.785	Coiled-coil domain-containing protein 39
11	9606.ENSP00000391692	0.775	Coiled-coil domain containing 103
12	9606.ENSP00000391869	0.774	annotation not available
13	9606.ENSP00000480538	0.764	Dynein intermediate chain 1, axonemal
14	9606.ENSP00000380679	0.757	Coiled-coil domain-containing protein 40
15	9606.ENSP00000290155	0.756	UPF0769 protein C21orf59
16	9606.ENSP00000400252	0.752	Dynein intermediate chain 2, axonemal
17	9606.ENSP00000444156	0.751	Armadillo repeat containing 6
18	9606.ENSP00000312399	0.742	Coiled-coil domain-containing protein 63
19	9606.ENSP00000288710	0.738	Dynein regulatory complex protein 1
20	9606.ENSP00000475939	0.738	Dynein heavy chain 11, axonemal

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0022607	0.996	cellular component assembly
GO:0007017	0.995	microtubule-based process
GO:0007010	0.995	cytoskeleton organization
GO:0003002	0.988	regionalization
GO:0035082	0.988	axoneme assembly
GO:0070286	0.977	axonemal dynein complex assembly
GO:0007018	0.973	microtubule-based movement
GO:0003341	0.963	cilium movement
GO:0060972	0.940	left/right pattern formation
GO:0009855	0.937	determination of bilateral symmetry
GO:0007368	0.928	determination of left/right symmetry
GO:0065007	0.741	biological regulation
GO:0050789	0.727	regulation of biological process
GO:0050794	0.716	regulation of cellular process
GO:0032886	0.546	regulation of microtubule-based process
GO:0003352	0.396	regulation of cilium movement
GO:0036158	0.345	outer dynein arm assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005929	0.998	cilium
GO:0005856	0.997	cytoskeleton
GO:0005930	0.989	axoneme
GO:0097546	0.884	ciliary base
GO:0043231	0.768	intracellular membrane-bounded organelle
GO:0005634	0.666	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]