StarFunc result for job id Q5T2W1

User Input

>input (519 residues)
MTSTFNPRECKLSKQEGQNYGFFLRIEKDTEGHLVRVVEKCSPAEKAGLQDGDRVLRING
VFVDKEEHMQVVDLVRKSGNSVTLLVLDGDSYEKAVKTRVDLKELGQSQKEQGLSDNILS
PVMNGGVQTWTQPRLCYLVKEGGSYGFSLKTVQGKKGVYMTDITPQGVAMRAGVLADDHL
IEVNGENVEDASHEEVVEKVKKSGSRVMFLLVDKETDKRHVEQKIQFKRETASLKLLPHQ
PRIVEMKKGSNGYGFYLRAGSEQKGQIIKDIDSGSPAEEAGLKNNDLVVAVNGESVETLD
HDSVVEMIRKGGDQTSLLVVDKETDNMYRLAHFSPFLYYQSQELPNGSVKEAPAPTPTSL
EVSSPPDTTEEVDHKPKLCRLAKGENGYGFHLNAIRGLPGSFIKEVQKGGPADLAGLEDE
DVIIEVNGVNVLDEPYEKVVDRIQSSGKNVTLLVCGKKAYDYFQAKKIPIVSSLADPLDT
PPDSKEGIVVESNHDSHMAKERAHSTASHSSSNSEDTEM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T2W1	1.000	1.000	1.334E-94	519	1.000	1.000	Q5T2W1.pdb.gz	NHRF3_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Homo sapiens OX=9606 GN=PDZK1 PE=1 SV=2
2	AFDB:Q865P3	0.485	0.486	4.333E-79	518	0.842	0.844	Q865P3.pdb.gz	NHRF3_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Oryctolagus cuniculus OX=9986 GN=PDZK1 PE=1 SV=1
3	AFDB:Q9JJ40	0.460	0.457	7.365E-78	523	0.782	0.776	Q9JJ40.pdb.gz	NHRF3_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Rattus norvegicus OX=10116 GN=Pdzk1 PE=1 SV=2
4	AFDB:Q86UT5	0.389	0.355	2.282E-38	571	0.285	0.259	Q86UT5.pdb.gz	NHRF4_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF4 OS=Homo sapiens OX=9606 GN=NHERF4 PE=1 SV=2
5	AFDB:Q99MJ6	0.388	0.403	1.509E-37	498	0.276	0.287	Q99MJ6.pdb.gz	NHRF4_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF4 OS=Mus musculus OX=10090 GN=Nherf4 PE=1 SV=1
6	AFDB:Q6RHR9	0.163	0.076	3.475E-26	1471	0.252	0.089	Q6RHR9.pdb.gz	MAGI1_MOUSE Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Mus musculus OX=10090 GN=Magi1 PE=1 SV=1
7	AFDB:E9QIL2	0.154	0.083	4.106E-26	1114	0.231	0.108	E9QIL2.pdb.gz
8	AFDB:F1Q897	0.159	0.065	4.340E-26	1503	0.235	0.081	F1Q897.pdb.gz	F1Q897_DANRE Membrane-associated guanylate kinase, WW and PDZ domain-containing 2a OS=Danio rerio OX=7955 GN=fb82g11 PE=4 SV=3
9	AFDB:Q5VSD9	0.177	0.083	1.180E-25	1274	0.235	0.096	Q5VSD9.pdb.gz
10	AFDB:F1NMZ1	0.175	0.078	1.318E-25	1256	0.237	0.098	F1NMZ1.pdb.gz
11	PDB:2xkxA	0.166	0.122	2.479E-17	721	0.181	0.130	2xkxA.pdb.gz
12	PDB:6pcvA	0.147	0.102	4.957E-7	754	0.087	0.060	6pcvA.pdb.gz
13	PDB:7pcbA	0.152	0.190	3.662E-6	415	0.069	0.087	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
14	PDB:3pv2B	0.105	0.136	7.969E-6	388	0.058	0.077	3pv2B.pdb.gz
15	PDB:5n7dA	0.150	0.182	2.559E-5	423	0.060	0.073	5n7dA.pdb.gz	Dynamic control of RSK complexes by phosphoswitch-based regulation.
16	PDB:7pc3A	0.158	0.201	3.378E-5	405	0.044	0.057	7pc3A.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
17	PDB:7p70A	0.147	0.187	5.268E-5	407	0.044	0.057	7p70A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
18	PDB:7qqmA	0.147	0.183	1.281E-4	413	0.048	0.061	7qqmA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:7p73A	0.149	0.183	1.354E-4	420	0.042	0.052	7p73A.pdb.gz	Quantitative fragmentomics allow affinity mapping of interactomes.
20	PDB:7pe9I	0.148	0.239	1.354E-4	317	0.050	0.082	7pe9I.pdb.gz	Regulation of human mTOR complexes by DEPTOR.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T2W1	0.0	1065	519	1.000	1.000	NHRF3_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Homo sapiens OX=9606 GN=PDZK1 PE=1 SV=2
2	Q865P3	0.0	890	518	0.852	0.853	NHRF3_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Oryctolagus cuniculus OX=9986 GN=PDZK1 PE=1 SV=1
3	Q9JIL4	0.0	807	519	0.784	0.784	NHRF3_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Mus musculus OX=10090 GN=Pdzk1 PE=1 SV=1
4	Q9JJ40	0.0	788	523	0.782	0.776	NHRF3_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF3 OS=Rattus norvegicus OX=10116 GN=Pdzk1 PE=1 SV=2
5	Q86UT5	1.60e-71	240	571	0.306	0.278	NHRF4_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF4 OS=Homo sapiens OX=9606 GN=NHERF4 PE=1 SV=2
6	Q99MJ6	9.21e-63	215	498	0.285	0.297	NHRF4_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF4 OS=Mus musculus OX=10090 GN=Nherf4 PE=1 SV=1
7	Q28619	7.96e-45	163	358	0.200	0.291	NHRF1_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Oryctolagus cuniculus OX=9986 GN=NHERF1 PE=1 SV=3
8	O14745	3.42e-44	161	358	0.197	0.285	NHRF1_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=NHERF1 PE=1 SV=4
9	Q9JJ19	2.16e-43	159	356	0.195	0.284	NHRF1_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Rattus norvegicus OX=10116 GN=Nherf1 PE=1 SV=3
10	P70441	2.70e-42	156	355	0.195	0.285	NHRF1_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Mus musculus OX=10090 GN=Nherf1 PE=1 SV=3
11	G3GTH2	2.91e-41	153	354	0.189	0.277	G3GTH2_CRIGR Na(+)/H(+) exchange regulatory cofactor NHE-RF OS=Cricetulus griseus OX=10029 GN=Slc9a3r1 PE=1 SV=1
12	Q8SQG9	6.29e-38	143	316	0.170	0.278	NHRF2_RABIT Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Oryctolagus cuniculus OX=9986 GN=NHERF2 PE=1 SV=1
13	Q9JHL1	8.44e-38	144	337	0.156	0.240	NHRF2_MOUSE Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Mus musculus OX=10090 GN=Nherf2 PE=1 SV=2
14	Q920G2	1.01e-37	143	337	0.171	0.264	NHRF2_RAT Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Rattus norvegicus OX=10116 GN=Nherf2 PE=1 SV=1
15	Q15599	1.50e-37	143	337	0.156	0.240	NHRF2_HUMAN Na(+)/H(+) exchange regulatory cofactor NHE-RF2 OS=Homo sapiens OX=9606 GN=NHERF2 PE=1 SV=2
16	Q6P2U7	3.35e-30	124	384	0.158	0.214	Q6P2U7_DANRE Na(+)/H(+) exchange regulatory cofactor NHE-RF OS=Danio rerio OX=7955 GN=nherf1a PE=1 SV=1
17	Q7ZVX1	3.53e-30	123	386	0.158	0.212	Q7ZVX1_DANRE Na(+)/H(+) exchange regulatory cofactor NHE-RF OS=Danio rerio OX=7955 GN=nherf1a PE=2 SV=1
18	A0A061I5T4	4.65e-23	105	934	0.146	0.081	A0A061I5T4_CRIGR E3 ubiquitin-protein ligase CBL (Fragment) OS=Cricetulus griseus OX=10029 GN=H671_4g13114 PE=1 SV=1
19	G5EDM4	3.79e-21	98.6	467	0.123	0.137	NHRF1_CAEEL Na(+)/H(+) exchange regulatory cofactor-like protein nrfl-1 OS=Caenorhabditis elegans OX=6239 GN=nrfl-1 PE=1 SV=1
20	Q62108	1.65e-18	91.3	724	0.166	0.119	DLG4_MOUSE Disks large homolog 4 OS=Mus musculus OX=10090 GN=Dlg4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12671 Amidase_6	7.8e+02	11.6	Putative amidase domain
2	PF11874 DUF3394	91	14.2	Domain of unknown function (DUF3394)
3	PF14085 DUF4265	11	17.4	Domain of unknown function (DUF4265)
4	PF19805 DUF6288	0.27	21.9	Family of unknown function (DUF6288)
5	PF04495 GRASP55_65	0.00027	32.7	GRASP55/65 PDZ-like domain
6	PF00595 PDZ	5.6e-53	188.6	PDZ domain
7	PF13180 PDZ_2	4.1e-25	99.3	PDZ domain
8	PF17820 PDZ_6	1e-42	155.1	PDZ domain
9	PF02163 Peptidase_M50	5.3e-21	86.8	Peptidase family M50
10	PF14685 Tricorn_PDZ	0.0008	30.7	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000394485

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000003084	0.996	Cystic fibrosis transmembrane conductance regulator
2	9606.ENSP00000261693	0.995	Scavenger receptor class B member 1
3	9606.ENSP00000294338	0.979	PDZK1-interacting protein 1
4	9606.ENSP00000366797	0.976	Solute carrier family 22 member 12
5	9606.ENSP00000359478	0.956	Canalicular multispecific organic anion transporter 1
6	9606.ENSP00000302716	0.950	Mucin-17
7	9606.ENSP00000343930	0.948	Kelch-like protein 17
8	9606.ENSP00000405330	0.936	Estrogen receptor
9	9606.ENSP00000225737	0.931	A-kinase anchor protein 10, mitochondrial
10	9606.ENSP00000264938	0.903	Sodium/hydrogen exchanger 3
11	9606.ENSP00000345873	0.899	Chloride anion exchanger
12	9606.ENSP00000244527	0.892	Sodium-dependent phosphate transport protein 1
13	9606.ENSP00000321424	0.890	Sodium-dependent phosphate transport protein 2A
14	9606.ENSP00000301891	0.876	Solute carrier family 22 member 11
15	9606.ENSP00000445340	0.870	Sodium-coupled monocarboxylate transporter 1
16	9606.ENSP00000417085	0.857	Solute carrier family 15 member 2
17	9606.ENSP00000444408	0.834	Neutral amino acid transporter B(0)
18	9606.ENSP00000265563	0.803	cAMP-dependent protein kinase type II-alpha regulatory subunit
19	9606.ENSP00000331983	0.794	F-actin-uncapping protein LRRC16A
20	9606.ENSP00000303507	0.782	Breakpoint cluster region protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019904	0.876	protein domain specific binding
GO:0030165	0.750	PDZ domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050789	0.986	regulation of biological process
GO:0009987	0.978	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0051179	0.973	localization
GO:1905477	0.848	positive regulation of protein localization to membrane
GO:0051050	0.797	positive regulation of transport
GO:0051234	0.794	establishment of localization
GO:0065009	0.756	regulation of molecular function
GO:0006810	0.728	transport
GO:0044093	0.725	positive regulation of molecular function
GO:0071702	0.674	organic substance transport
GO:0034762	0.663	regulation of transmembrane transport
GO:0071705	0.621	nitrogen compound transport
GO:0032409	0.598	regulation of transporter activity
GO:0015697	0.577	quaternary ammonium group transport
GO:0043269	0.544	regulation of monoatomic ion transport
GO:0072337	0.543	modified amino acid transport
GO:0034765	0.487	regulation of monoatomic ion transmembrane transport
GO:0034764	0.486	positive regulation of transmembrane transport
GO:0043270	0.450	positive regulation of monoatomic ion transport
GO:0032411	0.443	positive regulation of transporter activity
GO:0032501	0.438	multicellular organismal process
GO:0032412	0.359	regulation of monoatomic ion transmembrane transporter activity
GO:0015695	0.336	organic cation transport
GO:0034767	0.336	positive regulation of monoatomic ion transmembrane transport
GO:0050896	0.335	response to stimulus
GO:0032502	0.305	developmental process
GO:0032414	0.303	positive regulation of ion transmembrane transporter activity
GO:0008152	0.302	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.999	membrane-bounded organelle
GO:0031982	0.971	vesicle
GO:0005576	0.969	extracellular region
GO:0070062	0.957	extracellular exosome
GO:0005622	0.944	intracellular anatomical structure
GO:0005903	0.881	brush border
GO:0098590	0.877	plasma membrane region
GO:0005737	0.745	cytoplasm
GO:0042995	0.578	cell projection
GO:0120025	0.555	plasma membrane bounded cell projection
GO:0043229	0.490	intracellular organelle
GO:0043231	0.347	intracellular membrane-bounded organelle
GO:0045177	0.315	apical part of cell

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]