StarFunc result for job id Q5T3U5

User Input

>input (1492 residues)
MERLLAQLCGSSAAWPLPLWEGDTTGHCFTQLVLSALPHALLAVLSACYLGTPRSPDYIL
PCSPGWRLRLAASFLLSVFPLLDLLPVALPPGAGPGPIGLEVLAGCVAAVAWISHSLALW
VLAHSPHGHSRGPLALALVALLPAPALVLTVLWHCQRGTLLPPLLPGPMARLCLLILQLA
ALLAYALGWAAPGGPREPWAQEPLLPEDQEPEVAEDGESWLSRFSYAWLAPLLARGACGE
LRQPQDICRLPHRLQPTYLARVFQAHWQEGARLWRALYGAFGRCYLALGLLKLVGTMLGF
SGPLLLSLLVGFLEEGQEPLSHGLLYALGLAGGAVLGAVLQNQYGYEVYKVTLQARGAVL
NILYCKALQLGPSRPPTGEALNLLGTDSERLLNFAGSFHEAWGLPLQLAITLYLLYQQVG
VAFVGGLILALLLVPVNKVIATRIMASNQEMLQHKDARVKLVTELLSGIRVIKFCGWEQA
LGARVEACRARELGRLRVIKYLDAACVYLWAALPVVISIVIFITYVLMGHQLTATKVFTA
LALVRMLILPLNNFPWVINGLLEAKVSLDRIQLFLDLPNHNPQAYYSPDPPAEPSTVLEL
HGALFSWDPVGTSLETFISHLEVKKGMLVGIVGKVGCGKSSLLAAIAGELHRLRGHVAVR
GLSKGFGLATQEPWIQFATIRDNILFGKTFDAQLYKEVLEACALNDDLSILPAGDQTEVG
EKGVTLSGGQRARIALARAVYQEKELYLLDDPLAAVDADVANHLLHRCILGMLSYTTRLL
CTHRTEYLERADAVLLMEAGRLIRAGPPSEILPLVQAVPKAWAENGQESDSATAQSVQNP
EKTKEGLEEEQSTSGRLLQEESKKEGAVALHVYQAYWKAVGQGLALAILFSLLLMQATRN
AADWWLSHWISQLKAENSSQEAQPSTSPASMGLFSPQLLLFSPGNLYIPVFPLPKAAPNG
SSDIRFYLTVYATIAGVNSLCTLLRAVLFAAGTLQAAATLHRRLLHRVLMAPVTFFNATP
TGRILNRFSSDVACADDSLPFILNILLANAAGLLGLLAVLGSGLPWLLLLLPPLSIMYYH
VQRHYRASSRELRRLGSLTLSPLYSHLADTLAGLSVLRATGATYRFEEENLRLLELNQRC
QFATSATMQWLDIRLQLMGAAVVSAIAGIALVQHQQGLANPGLVGLSLSYALSLTGLLSG
LVSSFTQTEAMLVSVERLEEYTCDLPQEPQGQPLQLGTGWLTQGGVEFQDVVLAYRPGLP
NALDGVTFCVQPGEKLGIVGRTGSGKSSLLLVLFRLLEPSSGRVLLDGVDTSQLELAQLR
SQLAIIPQEPFLFSGTVRENLDPQGLHKDRALWQALKQCHLSEVITSMGGLDGELGEGGR
SLSLGQRQLLCLARALLTDAKILCIDEATASVDQKTDQLLQQTICKRFANKTVLTIAHRL
NTILNSDRVLVLQAGRVVELDSPATLRNQPHSLFQQLLQSSQQGVPASLGGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T3U5	1.000	1.000	0.000	1492	1.000	1.000	Q5T3U5.pdb.gz	MRP7_HUMAN ATP-binding cassette sub-family C member 10 OS=Homo sapiens OX=9606 GN=ABCC10 PE=1 SV=1
2	AFDB:Q7KTC0	0.814	0.785	2.893E-100	1549	0.347	0.334	Q7KTC0.pdb.gz	Q7KTC0_DROME Multidrug-Resistance like protein 1, isoform I OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
3	AFDB:Q54P13	0.815	0.765	5.003E-100	1593	0.323	0.303	Q54P13.pdb.gz	ABCC8_DICDI ABC transporter C family member 8 OS=Dictyostelium discoideum OX=44689 GN=abcC8 PE=3 SV=1
4	AFDB:O15438	0.826	0.808	7.427E-99	1527	0.332	0.325	O15438.pdb.gz	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
5	AFDB:Q9U2G5	0.782	0.766	1.057E-97	1525	0.305	0.298	Q9U2G5.pdb.gz	MRP7_CAEEL Multidrug resistance protein mrp-7 OS=Caenorhabditis elegans OX=6239 GN=mrp-7 PE=2 SV=3
6	AFDB:A0A0R4IC81	0.810	0.797	1.828E-97	1518	0.328	0.322	A0A0R4IC81.pdb.gz	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
7	AFDB:Q28689	0.790	0.756	4.819E-97	1564	0.309	0.295	Q28689.pdb.gz	MRP2_RABIT ATP-binding cassette sub-family C member 2 OS=Oryctolagus cuniculus OX=9986 GN=ABCC2 PE=1 SV=1
8	AFDB:B2RX12	0.822	0.806	5.950E-97	1523	0.332	0.325	B2RX12.pdb.gz	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
9	AFDB:Q63120	0.813	0.789	7.043E-97	1541	0.314	0.304	Q63120.pdb.gz	MRP2_RAT ATP-binding cassette sub-family C member 2 OS=Rattus norvegicus OX=10116 GN=Abcc2 PE=1 SV=1
10	AFDB:Q42093	0.759	0.700	1.325E-96	1623	0.322	0.296	Q42093.pdb.gz	AB2C_ARATH ABC transporter C family member 2 OS=Arabidopsis thaliana OX=3702 GN=ABCC2 PE=1 SV=2
11	PDB:7mpeA	0.738	0.768	1.683E-83	1428	0.302	0.316	7mpeA.pdb.gz
12	PDB:7s5xE	0.680	0.714	3.182E-80	1412	0.293	0.309	7s5xE.pdb.gz	Molecular structure of an open human K ATP channel.
13	PDB:6jb1B	0.747	0.811	3.825E-79	1366	0.289	0.316	6jb1B.pdb.gz	The Structural Basis for the Binding of Repaglinide to the Pancreatic KATPChannel.
14	PDB:7vluA	0.631	0.791	3.627E-77	1159	0.259	0.333	7vluA.pdb.gz	Structural identification of vasodilator binding sites on the SUR2 subunit.
15	PDB:6c3pE	0.678	0.736	5.704E-75	1359	0.287	0.315	6c3pE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP.
16	PDB:5ykfB	0.731	0.826	7.662E-75	1309	0.293	0.334	5ykfB.pdb.gz	Ligand binding and conformational changes of SUR1 subunit in pancreatic ATP-sensitive potassium channels.
17	PDB:6c3oE	0.602	0.686	2.966E-71	1290	0.280	0.324	6c3oE.pdb.gz	Molecular structure of human KATP in complex with ATP and ADP
18	PDB:7mitE	0.751	0.777	2.289E-66	1438	0.282	0.292	7mitE.pdb.gz	Vascular K ATP channel structural dynamics reveal regulatory mechanism by Mg-nucleotides.
19	PDB:6msmA	0.602	0.737	4.730E-60	1181	0.223	0.281	6msmA.pdb.gz	Molecular structure of the ATP-bound, phosphorylated human CFTR.
20	PDB:5wuaE	0.718	0.810	2.157E-59	1312	0.273	0.311	5wuaE.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MS99	719	1215	0.290	0.356	A0A0A0MS99_HUMAN ABC-type glutathione-S-conjugate transporter OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
2	A0A0B4KGI0	620	1408	0.290	0.308	A0A0B4KGI0_DROME Uncharacterized protein, isoform E OS=Drosophila melanogaster OX=7227 GN=Mrp5 PE=4 SV=1
3	A0A0R4IAS5	618	1557	0.286	0.274	A0A0R4IAS5_DANRE ATP-binding cassette sub-family C member 9 isoform X7 OS=Danio rerio OX=7955 GN=si:dkey-183c2.3 PE=4 SV=2
4	A0A0R4IC81	754	1518	0.315	0.310	A0A0R4IC81_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc1 PE=3 SV=1
5	A0A0S0WIA2	766	1492	0.312	0.312	A0A0S0WIA2_DROME Multidrug-Resistance like protein 1, isoform R OS=Drosophila melanogaster OX=7227 GN=MRP PE=1 SV=1
6	A0A1S4NYG1	603	1582	0.277	0.261	A0A1S4NYG1_MESAU SUR1 OS=Mesocricetus auratus OX=10036 PE=1 SV=1
7	A0A1U7R319	603	1582	0.277	0.261	A0A1U7R319_MESAU ATP-binding cassette sub-family C member 8 isoform X2 OS=Mesocricetus auratus OX=10036 GN=Abcc8 PE=1 SV=1
8	A0A1U8QTJ9	625	1396	0.287	0.307	CICA_EMENI ABC-type transporter cicA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=cicA PE=1 SV=1
9	A7KVC2	682	1510	0.308	0.305	AB4C_MAIZE ABC transporter C family MRP4 OS=Zea mays OX=4577 GN=MRP4 PE=2 SV=1
10	B2RX12	756	1523	0.312	0.306	MRP3_MOUSE ATP-binding cassette sub-family C member 3 OS=Mus musculus OX=10090 GN=Abcc3 PE=1 SV=2
11	E1B2R7	647	1426	0.282	0.295	E1B2R7_DANRE ATP-binding cassette sub-family C member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=2 SV=1
12	E7EYG0	659	1426	0.301	0.315	E7EYG0_DANRE ATP-binding cassette, sub-family C (CFTR/MRP), member 5 OS=Danio rerio OX=7955 GN=fj51h02 PE=4 SV=1
13	E7F118	717	1507	0.310	0.307	E7F118_DANRE ABC-type glutathione-S-conjugate transporter OS=Danio rerio OX=7955 GN=abcc6a PE=3 SV=1
14	E9Q236	714	1325	0.308	0.347	MRP4_MOUSE ATP-binding cassette sub-family C member 4 OS=Mus musculus OX=10090 GN=Abcc4 PE=1 SV=1
15	F1LR52	707	1288	0.304	0.352	F1LR52_RAT ATP binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=4
16	F1M3J4	710	1325	0.302	0.340	MRP4_RAT ATP-binding cassette subfamily C member 4 OS=Rattus norvegicus OX=10116 GN=Abcc4 PE=1 SV=3
17	G5EE72	596	1427	0.268	0.280	MRP5_CAEEL Multidrug resistance-associated protein 5 OS=Caenorhabditis elegans OX=6239 GN=mrp-5 PE=2 SV=1
18	I3L4X2	732	1440	0.296	0.306	I3L4X2_HUMAN ABC-type glutathione-S-conjugate transporter (Fragment) OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=1
19	O15438	730	1527	0.305	0.298	MRP3_HUMAN ATP-binding cassette sub-family C member 3 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3
20	O15439	702	1325	0.300	0.338	MRP4_HUMAN ATP-binding cassette sub-family C member 4 OS=Homo sapiens OX=9606 GN=ABCC4 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	0.086	24.7	AAA ATPase domain
2	PF13304 AAA_21	0.015	26.7	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13401 AAA_22	1.5e+02	14.1	AAA domain
4	PF13476 AAA_23	7.7	18.5	AAA domain
5	PF13555 AAA_29	0.074	24.1	P-loop containing region of AAA domain
6	PF13604 AAA_30	63	14.7	AAA domain
7	PF00664 ABC_membrane	1.7e-46	170.7	ABC transporter transmembrane region
8	PF00005 ABC_tran	5.7e-51	184.1	ABC transporter
9	PF19993 DO-GTPase2	5.3	18.3	Double-GTPase 2
10	PF01935 DUF87	22	16.6	Helicase HerA, central domain
11	PF00350 Dynamin_N	4e+02	12.5	Dynamin family
12	PF07693 KAP_NTPase	14	16.5	KAP family P-loop domain
13	PF01926 MMR_HSR1	0.25	22.8	50S ribosome-binding GTPase
14	PF00931 NB-ARC	2.2e+02	12.4	NB-ARC domain
15	PF03193 RsgA_GTPase	48	15.3	RsgA GTPase
16	PF02463 SMC_N	5.8e-07	40.7	RecF/RecN/SMC N terminal domain
17	PF06414 Zeta_toxin	5.1e+02	11.4	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000361608

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000357362	0.642	Thrombospondin-3
2	9606.ENSP00000245539	0.618	Mitochondrial ribosomal protein S7
3	9606.ENSP00000296577	0.583	ATP-binding cassette sub-family E member 1
4	9606.ENSP00000222388	0.574	ATP binding cassette subfamily F member 2
5	9606.ENSP00000481728	0.564	ATP-binding cassette sub-family G member 4
6	9606.ENSP00000354995	0.529	ATP-binding cassette sub-family G member 1
7	9606.ENSP00000313603	0.516	ATP-binding cassette sub-family F member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0015318	0.999	inorganic molecular entity transmembrane transporter activity
GO:0140359	0.999	ABC-type transporter activity
GO:0008559	0.993	ABC-type xenobiotic transporter activity
GO:0005488	0.992	binding
GO:0015103	0.990	inorganic anion transmembrane transporter activity
GO:1901682	0.989	sulfur compound transmembrane transporter activity
GO:0005515	0.969	protein binding
GO:0097159	0.961	organic cyclic compound binding
GO:1901363	0.958	heterocyclic compound binding
GO:0036094	0.946	small molecule binding
GO:0097367	0.861	carbohydrate derivative binding
GO:0000166	0.858	nucleotide binding
GO:0035639	0.837	purine ribonucleoside triphosphate binding
GO:0032555	0.819	purine ribonucleotide binding
GO:0005319	0.619	lipid transporter activity
GO:0043225	0.532	ATPase-coupled inorganic anion transmembrane transporter activity
GO:0005524	0.529	ATP binding
GO:0003824	0.465	catalytic activity
GO:0015431	0.463	ABC-type glutathione S-conjugate transporter activity
GO:0016787	0.395	hydrolase activity
GO:0016462	0.375	pyrophosphatase activity
GO:0017111	0.370	ribonucleoside triphosphate phosphatase activity
GO:0016887	0.315	ATP hydrolysis activity
GO:0008514	0.310	organic anion transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0006810	0.995	transport
GO:0015711	0.987	organic anion transport
GO:0071704	0.971	organic substance metabolic process
GO:0055085	0.936	transmembrane transport
GO:0044237	0.891	cellular metabolic process
GO:0046942	0.815	carboxylic acid transport
GO:0044281	0.764	small molecule metabolic process
GO:0006690	0.703	icosanoid metabolic process
GO:0065007	0.370	biological regulation
GO:0006807	0.321	nitrogen compound metabolic process
GO:0050789	0.308	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0005737	0.997	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0031090	0.945	organelle membrane
GO:0045178	0.872	basal part of cell
GO:0009925	0.864	basal plasma membrane
GO:0016323	0.841	basolateral plasma membrane
GO:0005773	0.694	vacuole
GO:0098588	0.675	bounding membrane of organelle
GO:0000323	0.526	lytic vacuole
GO:0098852	0.475	lytic vacuole membrane
GO:0012505	0.423	endomembrane system
GO:0005764	0.396	lysosome
GO:0005765	0.369	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.999	Translocases.
EC:7.6.2.2	0.993	ABC-type xenobiotic transporter.
RHEA:19121	0.463	an S-substituted glutathione(in) + ATP + H2O = ADP + an S-substituted glutathione(out) + H(+) + phosphate
EC:7.6.2.3	0.463	ABC-type glutathione-S-conjugate transporter.
EC:3.-.-.-	0.395	Hydrolases.
EC:3.6.1.-	0.375	In phosphorus-containing anhydrides.
RHEA:23680	0.370	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.370	nucleoside-triphosphate phosphatase.
RHEA:13065	0.315	ATP + H2O = ADP + H(+) + phosphate

[back to server]