StarFunc result for job id Q5T440

User Input

>input (356 residues)
MATAALLRGATPGRGGPVWRWRLRAAPRCRLAHSSCSPGGDPTAGAAWACFRLDGRTLLR
VRGPDAAPFLLGLLTNELPLPSPAAAGAPPAARAGYAHFLNVQGRTLYDVILYGLQEHSE
VSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVWAVLPSSPEACGAASLQERAG
AAAILIRDPRTARMGWRLLTQDEGPALVPGGRLGDLWDYHQHRYLQGVPEGVRDLPPGVA
LPLESNLAFMNGVSFTKGCYIGQELTARTHHMGVIRKRLFPVRFLDPLPTSGITPGATVL
TASGQTVGKFRAGQGNVGLALLWSEKIKGPLHIRASEGAQVALAASVPDWWPTVSK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T440	1.000	1.000	6.755E-75	356	1.000	1.000	Q5T440.pdb.gz	CAF17_HUMAN Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1
2	PDB:6qe4A	0.851	0.982	7.879E-59	308	0.865	1.000	6qe4A.pdb.gz	In-house high-energy-remote SAD phasing using the magic triangle: how to tackle the P1 low symmetry using multiple orientations of the same crystal of human IBA57 to increase the multiplicity.
3	AFDB:Q8CAK1	0.854	0.849	6.374E-55	358	0.705	0.701	Q8CAK1.pdb.gz	CAF17_MOUSE Putative transferase CAF17 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Iba57 PE=1 SV=1
4	AFDB:B8JMH0	0.791	0.796	3.350E-39	354	0.435	0.438	B8JMH0.pdb.gz	CAF17_DANRE Putative transferase CAF17 homolog, mitochondrial OS=Danio rerio OX=7955 GN=iba57 PE=3 SV=1
5	AFDB:Q8L733	0.718	0.654	3.963E-29	393	0.331	0.300	Q8L733.pdb.gz	Y4121_ARATH Putative transferase At4g12130, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g12130 PE=1 SV=1
6	AFDB:Q09929	0.670	0.730	2.469E-23	325	0.267	0.292	Q09929.pdb.gz	CAF17_SCHPO Putative transferase caf17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=caf17 PE=3 SV=1
7	AFDB:D6XM32	0.678	0.709	2.612E-23	339	0.287	0.301	D6XM32.pdb.gz	D6XM32_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.220 PE=4 SV=1
8	AFDB:Q4QAF7	0.642	0.623	1.263E-22	368	0.289	0.280	Q4QAF7.pdb.gz	Q4QAF7_LEIMA Aminomethyltransferase folate-binding domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_24_1740 PE=4 SV=1
9	AFDB:P47158	0.664	0.486	1.781E-21	497	0.270	0.193	P47158.pdb.gz	CAF17_YEAST Putative transferase CAF17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IBA57 PE=1 SV=1
10	AFDB:Q681Y3	0.646	0.541	8.806E-17	432	0.225	0.185	Q681Y3.pdb.gz	Y1099_ARATH Putative transferase At1g60990, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g60990 PE=1 SV=1
11	AFDB:O65396	0.630	0.558	2.872E-16	408	0.154	0.135	O65396.pdb.gz	GCST_ARATH Aminomethyltransferase, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=GDCST PE=2 SV=1
12	PDB:1nrkA	0.634	0.687	1.857E-15	325	0.185	0.203	1nrkA.pdb.gz
13	PDB:1vloA	0.619	0.608	9.505E-15	364	0.154	0.151	1vloA.pdb.gz
14	PDB:1wsvA	0.618	0.596	4.108E-14	371	0.146	0.140	1wsvA.pdb.gz	Crystal Structure of Human T-protein of Glycine Cleavage System at 2.0A Resolution and its Implication for Understanding Non-ketotic Hyperglycinemia
15	PDB:4pabB	0.633	0.295	4.864E-14	824	0.138	0.059	4pabB.pdb.gz	Folate in demethylation: The crystal structure of the rat dimethylglycine dehydrogenase complexed with tetrahydrofolate.
16	PDB:7c79B	0.435	0.220	1.416E-3	793	0.160	0.072	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
17	PDB:6ahrB	0.240	0.123	3.295E-3	774	0.039	0.018	6ahrB.pdb.gz	Cryo-EM Structure of the Human Ribonuclease P Holoenzyme.
18	PDB:7p2eH	0.127	0.287	4.914E-2	140	0.053	0.136	7p2eH.pdb.gz	Structure of the mitoribosomal small subunit with streptomycin reveals Fe-S clusters and physiological molecules.
19	PDB:4je3A	0.154	0.207	5.499E-2	244	0.059	0.086	4je3A.pdb.gz
20	PDB:7pntH	0.126	0.286	8.155E-2	140	0.039	0.100	7pntH.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T440	0.0	712	356	1.000	1.000	CAF17_HUMAN Putative transferase CAF17, mitochondrial OS=Homo sapiens OX=9606 GN=IBA57 PE=1 SV=1
2	Q8CAK1	5.39e-177	497	358	0.711	0.707	CAF17_MOUSE Putative transferase CAF17 homolog, mitochondrial OS=Mus musculus OX=10090 GN=Iba57 PE=1 SV=1
3	B8JMH0	2.86e-94	286	354	0.430	0.432	CAF17_DANRE Putative transferase CAF17 homolog, mitochondrial OS=Danio rerio OX=7955 GN=iba57 PE=3 SV=1
4	Q8L733	1.01e-42	154	393	0.331	0.300	Y4121_ARATH Putative transferase At4g12130, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g12130 PE=1 SV=1
5	Q09929	1.38e-40	147	325	0.289	0.317	CAF17_SCHPO Putative transferase caf17, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=caf17 PE=3 SV=1
6	Q4QAF7	2.89e-26	109	368	0.306	0.296	Q4QAF7_LEIMA Aminomethyltransferase folate-binding domain-containing protein OS=Leishmania major OX=5664 GN=LMJF_24_1740 PE=4 SV=1
7	D6XM32	4.53e-24	103	339	0.287	0.301	D6XM32_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.220 PE=4 SV=1
8	Q57TW5	4.51e-20	91.7	316	0.258	0.291	Q57TW5_TRYB2 Aminomethyltransferase folate-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb927.8.6480 PE=4 SV=1
9	P47158	2.33e-18	88.2	497	0.247	0.177	CAF17_YEAST Putative transferase CAF17, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=IBA57 PE=1 SV=1
10	P0ADE8	5.94e-05	46.6	326	0.154	0.169	YGFZ_ECOLI tRNA-modifying protein YgfZ OS=Escherichia coli (strain K12) OX=83333 GN=ygfZ PE=1 SV=2
11	Q681Y3	0.003	41.6	432	0.101	0.083	Y1099_ARATH Putative transferase At1g60990, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g60990 PE=1 SV=1
12	O53825	0.33	35.0	368	0.132	0.128	O53825_MYCTO Aminomethyltransferase folate-binding domain-containing protein OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=MT0832 PE=4 SV=1
13	P57768	0.77	33.9	344	0.121	0.125	SNX16_HUMAN Sorting nexin-16 OS=Homo sapiens OX=9606 GN=SNX16 PE=1 SV=2
14	K4PZ75	1.1	33.9	510	0.081	0.057	K4PZ75_HUMAN Ig superfamily receptor LNIR OS=Homo sapiens OX=9606 GN=LNIR PE=2 SV=1
15	P57769	1.1	33.5	344	0.124	0.128	SNX16_RAT Sorting nexin-16 OS=Rattus norvegicus OX=10116 GN=Snx16 PE=1 SV=2
16	Q96NY8	1.1	33.9	510	0.081	0.057	NECT4_HUMAN Nectin-4 OS=Homo sapiens OX=9606 GN=NECTIN4 PE=1 SV=1
17	Q8NHP7	2.0	32.7	514	0.059	0.041	EXD1_HUMAN piRNA biogenesis protein EXD1 OS=Homo sapiens OX=9606 GN=EXD1 PE=1 SV=4
18	Q92457	4.3	32.0	746	0.090	0.043	AGAL2_HYPJE Alpha-galactosidase 2 OS=Hypocrea jecorina OX=51453 GN=agl2 PE=1 SV=1
19	P71847	4.7	31.6	355	0.110	0.110	IPDC_MYCTU (3aS,4S,5R,7aS)-5-hydroxy-7a-methyl-1-oxo-octahydro-1H-indene-4-carboxyl-CoA dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ipdC PE=1 SV=3
20	A0A0B4KI07	8.4	31.2	2684	0.084	0.011	A0A0B4KI07_DROME Uncharacterized protein, isoform C OS=Drosophila melanogaster OX=7227 GN=Bicra PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01571 GCV_T	45	14.7	Aminomethyltransferase folate-binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355672

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000452007	0.997	Iron-sulfur cluster assembly 2 homolog, mitochondrial
2	9606.ENSP00000365159	0.993	Iron-sulfur cluster assembly 1 homolog, mitochondrial
3	9606.ENSP00000387219	0.959	NFU1 iron-sulfur cluster scaffold homolog, mitochondrial
4	9606.ENSP00000331369	0.942	BolA-like protein 3
5	9606.ENSP00000328570	0.937	Glutaredoxin-related protein 5, mitochondrial
6	9606.ENSP00000261434	0.925	Lipoyl synthase, mitochondrial
7	9606.ENSP00000216027	0.916	Iron-sulfur cluster co-chaperone protein HscB, mitochondrial
8	9606.ENSP00000420026	0.905	LYR motif-containing protein 4
9	9606.ENSP00000310623	0.890	Iron-sulfur cluster assembly enzyme ISCU, mitochondrial
10	9606.ENSP00000363205	0.882	Cysteine desulfurase, mitochondrial
11	9606.ENSP00000366482	0.854	Frataxin, mitochondrial
12	9606.ENSP00000281081	0.839	Iron-sulfur protein NUBPL
13	9606.ENSP00000377311	0.829	Ferredoxin-2, mitochondrial
14	9606.ENSP00000253577	0.824	ATP-binding cassette sub-family B member 7, mitochondrial
15	9606.ENSP00000358149	0.799	BolA-like protein 1
16	9606.ENSP00000377914	0.781	Anamorsin
17	9606.ENSP00000283027	0.757	Cytosolic Fe-S cluster assembly factor NUBP1
18	9606.ENSP00000357633	0.756	Glutaredoxin-3
19	9606.ENSP00000360576	0.739	NADPH-dependent diflavin oxidoreductase 1
20	9606.ENSP00000251588	0.729	Cytosolic Fe-S cluster assembly factor NARFL

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003824	0.819	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044237	0.998	cellular metabolic process
GO:0071704	0.996	organic substance metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:1901360	0.987	organic cyclic compound metabolic process
GO:0006725	0.985	cellular aromatic compound metabolic process
GO:0044238	0.976	primary metabolic process
GO:1901564	0.965	organonitrogen compound metabolic process
GO:0046483	0.913	heterocycle metabolic process
GO:0034641	0.910	cellular nitrogen compound metabolic process
GO:0043170	0.746	macromolecule metabolic process
GO:0065007	0.396	biological regulation
GO:0050789	0.384	regulation of biological process
GO:0009058	0.369	biosynthetic process
GO:1901566	0.344	organonitrogen compound biosynthetic process
GO:1901362	0.332	organic cyclic compound biosynthetic process
GO:0044249	0.331	cellular biosynthetic process
GO:0044271	0.321	cellular nitrogen compound biosynthetic process
GO:0018130	0.315	heterocycle biosynthetic process
GO:0019438	0.301	aromatic compound biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0070013	0.969	intracellular organelle lumen
GO:0031981	0.418	nuclear lumen
GO:0005654	0.392	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]