StarFunc result for job id Q5T447

User Input

>input (861 residues)
MAGPGPGAVLESPRQLLGRVRFLAEAARSLRAGRPLPAALAFVPREVLYKLYKDPAGPSR
VLLPVWEAEGLGLRVGAAGPAPGTGSGPLRAARDSIELRRGACVRTTGEELCNGHGLWVK
LTKEQLAEHLGDCGLQEGWLLVCRPAEGGARLVPIDTPNHLQRQQQLFGVDYRPVLRWEQ
VVDLTYSHRLGSRPQPAEAYAEAVQRLLYVPPTWTYECDEDLIHFLYDHLGKEDENLGSV
KQYVESIDVSSYTEEFNVSCLTDSNADTYWESDGSQCQHWVRLTMKKGTIVKKLLLTVDT
TDDNFMPKRVVVYGGEGDNLKKLSDVSIDETLIGDVCVLEDMTVHLPIIEIRIVECRDDG
IDVRLRGVKIKSSRQRELGLNADLFQPTSLVRYPRLEGTDPEVLYRRAVLLQRFIKILDS
VLHHLVPAWDHTLGTFSEIKQVKQFLLLSRQRPGLVAQCLRDSESSKPSFMPRLYINRRL
AMEHRACPSRDPACKNAVFTQVYEGLKPSDKYEKPLDYRWPMRYDQWWECKFIAEGIIDQ
GGGFRDSLADMSEELCPSSADTPVPLPFFVRTANQGNGTGEARDMYVPNPSCRDFAKYEW
IGQLMGAALRGKEFLVLALPGFVWKQLSGEEVSWSKDFPAVDSVLVKLLEVMEGMDKETF
EFKFGKELTFTTVLSDQQVVELIPGGAGIVVGYGDRSRFIQLVQKARLEESKEQVAAMQA
GLLKVVPQAVLDLLTWQELEKKVCGDPEVTVDALRKLTRFEDFEPSDSRVQYFWEALNNF
TNEDRSRFLRFVTGRSRLPARIYIYPDKLGYETTDALPESSTCSSTLFLPHYASAKVCEE
KLRYAAYNCVAIDTDMSPWEE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3U487	0.974	0.974	0.000	861	0.977	0.977	Q3U487.pdb.gz	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
2	AFDB:Q9UTG2	0.265	0.330	6.191E-20	671	0.128	0.164	Q9UTG2.pdb.gz	PUB2_SCHPO E3 ubiquitin-protein ligase pub2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pub2 PE=1 SV=1
3	AFDB:Q9W196	0.288	0.227	8.191E-20	1122	0.121	0.093	Q9W196.pdb.gz	Q9W196_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG3356 PE=1 SV=1
4	AFDB:A2A5Z6	0.250	0.281	8.582E-20	748	0.173	0.199	A2A5Z6.pdb.gz	SMUF2_MOUSE E3 ubiquitin-protein ligase SMURF2 OS=Mus musculus OX=10090 GN=Smurf2 PE=1 SV=1
5	AFDB:Q8T3L0	0.285	0.259	9.870E-20	964	0.113	0.101	Q8T3L0.pdb.gz	Q8T3L0_DROME SD03277p OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=2 SV=1
6	AFDB:Q9V853	0.263	0.219	1.810E-19	1061	0.108	0.088	Q9V853.pdb.gz	SMUF1_DROME E3 ubiquitin-protein ligase Smurf1 OS=Drosophila melanogaster OX=7227 GN=Smurf PE=1 SV=3
7	AFDB:Q8IVU3	0.271	0.235	2.754E-19	1022	0.111	0.094	Q8IVU3.pdb.gz	HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens OX=9606 GN=HERC6 PE=1 SV=2
8	AFDB:Q9CUN6	0.263	0.301	2.754E-19	731	0.163	0.192	Q9CUN6.pdb.gz	SMUF1_MOUSE E3 ubiquitin-protein ligase SMURF1 OS=Mus musculus OX=10090 GN=Smurf1 PE=1 SV=2
9	AFDB:A0A0G2K612	0.272	0.313	4.391E-19	731	0.154	0.182	A0A0G2K612.pdb.gz	A0A0G2K612_RAT E3 ubiquitin-protein ligase OS=Rattus norvegicus OX=10116 GN=Smurf1 PE=4 SV=2
10	AFDB:F2Z461	0.280	0.246	5.050E-19	1003	0.103	0.089	F2Z461.pdb.gz	HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus OX=10090 GN=Herc6 PE=2 SV=1
11	PDB:7mopA	0.255	0.105	7.253E-17	2445	0.117	0.041	7mopA.pdb.gz	Solenoid architecture of HUWE1 contributes to ligase activity and substrate recognition.
12	PDB:7jq9A	0.216	0.093	7.962E-17	2427	0.132	0.047	7jq9A.pdb.gz
13	PDB:7z8bC	0.149	0.106	1.242E-12	1224	0.108	0.076	7z8bC.pdb.gz	Structure of CRL7 FBXW8 reveals coupling with CUL1-RBX1/ROC1 for multi-cullin-RING E3-catalyzed ubiquitin ligation.
14	PDB:7qe7L	0.142	0.642	1.333E-8	183	0.044	0.208	7qe7L.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
15	PDB:8a3tA	0.150	0.546	1.251E-7	219	0.039	0.155	8a3tA.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
16	PDB:1xpwA	0.126	0.677	1.188E-4	143	0.019	0.112	1xpwA.pdb.gz
17	PDB:1xoyA	0.139	0.631	5.536E-4	161	0.016	0.087	1xoyA.pdb.gz
18	PDB:1o59A	0.118	0.302	9.688E-4	318	0.019	0.050	1o59A.pdb.gz
19	PDB:6mdsA	0.111	0.120	1.064E-3	787	0.016	0.018	6mdsA.pdb.gz	Molecular Basis of Broad SpectrumN-Glycan Specificity and Processing of Therapeutic IgG Monoclonal Antibodies by Endoglycosidase S2.
20	PDB:1k12A	0.130	0.615	1.167E-3	158	0.021	0.114	1k12A.pdb.gz	A novel fucose recognition fold involved in innate immunity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U487	0.0	1734	861	0.978	0.978	HECD3_MOUSE E3 ubiquitin-protein ligase HECTD3 OS=Mus musculus OX=10090 GN=Hectd3 PE=1 SV=2
2	Q5T447	0.0	1768	861	1.000	1.000	HECD3_HUMAN E3 ubiquitin-protein ligase HECTD3 OS=Homo sapiens OX=9606 GN=HECTD3 PE=1 SV=1
3	Q15751	5.53e-53	204	4861	0.148	0.026	HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2
4	E9PZP8	1.77e-52	202	4859	0.148	0.026	E9PZP8_MOUSE HECT and RLD domain containing E3 ubiquitin protein ligase family member 1 OS=Mus musculus OX=10090 GN=Herc1 PE=1 SV=1
5	Q54L33	3.87e-52	201	5222	0.150	0.025	Q54L33_DICDI HECT domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0286931 PE=4 SV=1
6	Q4U2R1	1.73e-49	193	4836	0.142	0.025	HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus OX=10090 GN=Herc2 PE=1 SV=3
7	O95714	1.14e-48	190	4834	0.139	0.025	HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens OX=9606 GN=HERC2 PE=1 SV=2
8	Q57UU4	3.99e-25	115	6613	0.121	0.016	Q57UU4_TRYB2 B30.2/SPRY domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.370 PE=4 SV=1
9	P51593	5.78e-25	115	4454	0.092	0.018	HUWE1_RAT E3 ubiquitin-protein ligase HUWE1 OS=Rattus norvegicus OX=10116 GN=Huwe1 PE=1 SV=3
10	Q7TMY8	5.82e-25	115	4377	0.092	0.018	HUWE1_MOUSE E3 ubiquitin-protein ligase HUWE1 OS=Mus musculus OX=10090 GN=Huwe1 PE=1 SV=5
11	Q7Z6Z7	6.73e-25	114	4374	0.092	0.018	HUWE1_HUMAN E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1 PE=1 SV=3
12	Q8T3L0	3.89e-24	111	964	0.088	0.079	Q8T3L0_DROME SD03277p OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=2 SV=1
13	X2JF83	5.43e-24	111	5101	0.088	0.015	X2JF83_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
14	X2JC16	5.77e-24	111	5150	0.088	0.015	X2JC16_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
15	X2JFK0	5.77e-24	111	5145	0.088	0.015	X2JFK0_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
16	Q9VXR3	5.87e-24	111	5146	0.088	0.015	Q9VXR3_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=2
17	X2JDY2	5.87e-24	111	5116	0.088	0.015	X2JDY2_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
18	X2JKH9	5.87e-24	111	5127	0.088	0.015	X2JKH9_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
19	X2JF73	5.97e-24	111	5151	0.088	0.015	X2JF73_DROME HECT-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=HUWE1 PE=1 SV=1
20	Q03280	2.20e-23	109	3268	0.101	0.027	TOM1_YEAST E3 ubiquitin-protein ligase TOM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TOM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03256 ANAPC10	2.4e-10	51.9	Anaphase-promoting complex, subunit 10 (APC10)
2	PF00754 F5_F8_type_C	22	16.6	F5/8 type C domain
3	PF00632 HECT	1.4e-48	177.5	HECT-domain (ubiquitin-transferase)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000002862

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000010904	0.827	Thyroid hormone receptor interactor 12
2	9555.ENSPANP00000017405	0.736	Transformation/transcription domain-associated protein
3	9555.ENSPANP00000019479	0.707	pre-mRNA processing factor 8
4	9555.ENSPANP00000010628	0.667	KIAA1109
5	9555.ENSPANP00000007691	0.665	Ubiquitin protein ligase E3 component n-recognin 1
6	9555.ENSPANP00000012654	0.665	Ubiquitin protein ligase E3 component n-recognin 2
7	9555.ENSPANP00000019833	0.663	Transcription elongation factor that enhances transcription elongation by RNA polymerase II (RNAPII).
8	9555.ENSPANP00000003650	0.647	Vacuolar protein sorting 13 homolog D (S. cerevisiae)
9	9555.ENSPANP00000002052	0.635	UBX domain protein 7
10	9555.ENSPANP00000012512	0.625	Belongs to the BolA/IbaG family.
11	9555.ENSPANP00000002581	0.624	40S ribosomal protein S30
12	9555.ENSPANP00000002553	0.591	Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus
13	9555.ENSPANP00000015743	0.591	Plays a role in the organization of the endoplasmic reticulum exit sites (ERES), also known as transitional endoplasmic reticulum (tER). Required for secretory cargo traffic from the endoplasmic reticulum to the Golgi apparatus
14	9555.ENSPANP00000007093	0.589	O-linked N-acetylglucosamine (GlcNAc) transferase
15	9555.ENSPANP00000020165	0.586	Zinc finger, AN1-type domain 4
16	9555.ENSPANP00000015367	0.558	Belongs to the PI3/PI4-kinase family.
17	9555.ENSPANP00000015630	0.558	SMG1, nonsense mediated mRNA decay associated PI3K related kinase
18	9555.ENSPANP00000015778	0.558	Serine/threonine-protein kinase mTOR
19	9555.ENSPANP00000018991	0.545	KIAA0368
20	9555.ENSPANP00000005213	0.544	Ubiquitin-like 4A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004842	1.000	ubiquitin-protein transferase activity
GO:0019905	0.885	syntaxin binding
GO:0061659	0.713	ubiquitin-like protein ligase activity
GO:0061630	0.697	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0009987	0.989	cellular process
GO:0019538	0.989	protein metabolic process
GO:0019941	0.975	modification-dependent protein catabolic process
GO:0006511	0.971	ubiquitin-dependent protein catabolic process
GO:0043161	0.945	proteasome-mediated ubiquitin-dependent protein catabolic process
GO:0065007	0.752	biological regulation
GO:0050789	0.729	regulation of biological process
GO:0050794	0.666	regulation of cellular process
GO:0036211	0.454	protein modification process
GO:0032446	0.436	protein modification by small protein conjugation
GO:0016567	0.375	protein ubiquitination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.949	cytosol
GO:0048471	0.899	perinuclear region of cytoplasm
GO:0005634	0.842	nucleus
GO:0031981	0.419	nuclear lumen
GO:0005654	0.389	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]