StarFunc result for job id Q5T481

User Input

>input (1227 residues)
MVLAAAMSQDADPSGPEQPDRVACSVPGARASPAPSGPRGMQQPPPPPQPPPPPQAGLPQ
IIQNAAKLLDKNPFSVSNPNPLLPSPASLQLAQLQAQLTLHRLKLAQTAVTNNTAAATVL
NQVLSKVAMSQPLFNQLRHPSVITGPHGHAGVPQHAAAIPSTRFPSNAIAFSPPSQTRGP
GPSMNLPNQPPSAMVMHPFTGVMPQTPGQPAVILGIGKTGPAPATAGFYEYGKASSGQTY
GPETDGQPGFLPSSASTSGSVTYEGHYSHTGQDGQAAFSKDFYGPNSQGSHVASGFPAEQ
AGGLKSEVGPLLQGTNSQWESPHGFSGQSKPDLTAGPMWPPPHNQPYELYDPEEPTSDRT
PPSFGGRLNNSKQGFIGAGRRAKEDQALLSVRPLQAHELNDFHGVAPLHLPHICSICDKK
VFDLKDWELHVKGKLHAQKCLVFSENAGIRCILGSAEGTLCASPNSTAVYNPAGNEDYAS
NLGTSYVPIPARSFTQSSPTFPLASVGTTFAQRKGAGRVVHICNLPEGSCTENDVINLGL
PFGKVTNYILMKSTNQAFLEMAYTEAAQAMVQYYQEKSAVINGEKLLIRMSKRYKELQLK
KPGKAVAAIIQDIHSQRERDMFREADRYGPERPRSRSPVSRSLSPRSHTPSFTSCSSSHS
PPGPSRADWGNGRDSWEHSPYARREEERDPAPWRDNGDDKRDRMDPWAHDRKHHPRQLDK
AELDERPEGGRPHREKYPRSGSPNLPHSVSSYKSREDGYYRKEPKAKWDKYLKQQQDAPG
RSRRKDEARLRESRHPHPDDSGKEDGLGPKVTRAPEGAKAKQNEKNKTKRTDRDQEGADD
RKENTMAENEAGKEEQEGMEESPQSVGRQEKEAEFSDPENTRTKKEQDWESESEAEGESW
YPTNMEELVTVDEVGEEEDFIVEPDIPELEEIVPIDQKDKICPETCLCVTTTLDLDLAQD
FPKEGVKAVGNGAAEISLKSPRELPSASTSCPSDMDVEMPGLNLDAERKPAESETGLSLE
DSDCYEKEAKGVESSDVHPAPTVQQMSSPKPAEERARQPSPFVDDCKTRGTPEDGACEGS
PLEEKASPPIETDLQNQACQEVLTPENSRYVEMKSLEVRSPEYTEVELKQPLSLPSWEPE
DVFSELSIPLGVEFVVPRTGFYCKLCGLFYTSEETAKMSHCRSAVHYRNLQKYLSQLAEE
GLKETEGADSPRPEDSGIVPRFERKKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PT37	0.208	0.211	0.000	1207	0.778	0.791	E9PT37.pdb.gz	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
2	AFDB:Q5T481	0.999	0.999	0.000	1227	1.000	1.000	Q5T481.pdb.gz	RBM20_HUMAN RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=4
3	AFDB:Q5EXX3	0.045	0.045	1.392E-7	1203	0.134	0.137	Q5EXX3.pdb.gz	ZBT38_RAT Zinc finger and BTB domain-containing protein 38 OS=Rattus norvegicus OX=10116 GN=Zbtb38 PE=2 SV=1
4	AFDB:Q9JKC9	0.042	0.041	2.510E-5	1329	0.156	0.144	Q9JKC9.pdb.gz	SYNRG_RAT Synergin gamma OS=Rattus norvegicus OX=10116 GN=Synrg PE=1 SV=3
5	PDB:7dvqY	0.066	0.477	2.983E-5	140	0.015	0.129	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
6	AFDB:Q7KHG2	0.062	0.055	5.454E-5	1486	0.157	0.130	Q7KHG2.pdb.gz	JING_DROME Zinc finger protein jing OS=Drosophila melanogaster OX=7227 GN=jing PE=2 SV=1
7	AFDB:Q9UPN6	0.064	0.062	5.454E-5	1271	0.124	0.120	Q9UPN6.pdb.gz	SCAF8_HUMAN SR-related and CTD-associated factor 8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1
8	PDB:7ohxo	0.064	0.587	9.845E-5	112	0.016	0.179	7ohxo.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
9	AFDB:Q8IK49	0.040	0.039	9.908E-5	1263	0.122	0.119	Q8IK49.pdb.gz	Q8IK49_PLAF7 EMP1-trafficking protein OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1478600 PE=4 SV=1
10	PDB:3lqvB	0.064	0.597	1.178E-4	115	0.011	0.122	3lqvB.pdb.gz	Branch Recognition by SF3b14
11	PDB:6n7rC	0.058	0.435	1.409E-4	133	0.015	0.143	6n7rC.pdb.gz	A unified mechanism for intron and exon definition and back-splicing.
12	AFDB:P19538	0.039	0.035	1.418E-4	1397	0.145	0.127	P19538.pdb.gz	CI_DROME Transcriptional activator cubitus interruptus OS=Drosophila melanogaster OX=7227 GN=ci PE=1 SV=2
13	AFDB:Q9R0I7	0.033	0.030	1.598E-4	1386	0.147	0.130	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
14	PDB:5xjcw	0.058	0.666	2.884E-4	91	0.013	0.176	5xjcw.pdb.gz	An Atomic Structure of the Human Spliceosome
15	AFDB:O95104	0.072	0.076	2.902E-4	1147	0.123	0.132	O95104.pdb.gz	SCAF4_HUMAN SR-related and CTD-associated factor 4 OS=Homo sapiens OX=9606 GN=SCAF4 PE=1 SV=3
16	PDB:5gm6V	0.062	0.530	3.662E-4	128	0.015	0.148	5gm6V.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6exnY	0.063	0.796	5.904E-4	87	0.014	0.195	6exnY.pdb.gz	Postcatalytic spliceosome structure reveals mechanism of 3'-splice site selection.
18	PDB:6ff7X	0.060	0.407	6.267E-4	171	0.015	0.105	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6gd1A	0.056	0.333	7.958E-4	190	0.015	0.100	6gd1A.pdb.gz
20	PDB:6id0O	0.061	0.249	1.010E-3	290	0.013	0.055	6id0O.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PT37	0.0	1873	1207	0.778	0.791	RBM20_RAT RNA-binding protein 20 OS=Rattus norvegicus OX=10116 GN=Rbm20 PE=1 SV=1
2	P0DW16	0.0	2019	1223	0.859	0.862	RBM20_PIG RNA-binding protein 20 OS=Sus scrofa OX=9823 GN=RBM20 PE=1 SV=1
3	Q3UQS8	0.0	1855	1199	0.773	0.791	RBM20_MOUSE RNA-binding protein 20 OS=Mus musculus OX=10090 GN=Rbm20 PE=1 SV=3
4	Q5T481	0.0	2524	1227	0.999	0.999	RBM20_HUMAN RNA-binding protein 20 OS=Homo sapiens OX=9606 GN=RBM20 PE=1 SV=4
5	Q8K310	6.75e-21	101	846	0.054	0.078	MATR3_MOUSE Matrin-3 OS=Mus musculus OX=10090 GN=Matr3 PE=1 SV=1
6	P43244	6.92e-21	101	845	0.054	0.078	MATR3_RAT Matrin-3 OS=Rattus norvegicus OX=10116 GN=Matr3 PE=1 SV=2
7	P43243	7.69e-21	101	847	0.054	0.078	MATR3_HUMAN Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2
8	Q00438	8.59e-15	81.3	556	0.033	0.072	PTBP1_RAT Polypyrimidine tract-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ptbp1 PE=1 SV=2
9	P17225	1.78e-14	80.5	555	0.033	0.072	PTBP1_MOUSE Polypyrimidine tract-binding protein 1 OS=Mus musculus OX=10090 GN=Ptbp1 PE=1 SV=3
10	P26599	1.83e-14	80.5	557	0.033	0.074	PTBP1_HUMAN Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=2
11	Q503D3	4.65e-13	75.9	574	0.032	0.068	Q503D3_DANRE Polypyrimidine tract-binding protein 1 OS=Danio rerio OX=7955 GN=ptbp1 PE=1 SV=1
12	Q9UKA9	5.62e-13	75.5	531	0.033	0.077	PTBP2_HUMAN Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2 PE=1 SV=1
13	Q66H20	5.67e-13	75.5	531	0.033	0.077	PTBP2_RAT Polypyrimidine tract-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Ptbp2 PE=1 SV=1
14	Q91Z31	5.67e-13	75.5	531	0.033	0.077	PTBP2_MOUSE Polypyrimidine tract-binding protein 2 OS=Mus musculus OX=10090 GN=Ptbp2 PE=1 SV=2
15	Q80XZ1	5.99e-11	68.9	588	0.028	0.058	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
16	Q8BHD7	1.87e-10	67.4	523	0.026	0.061	PTBP3_MOUSE Polypyrimidine tract-binding protein 3 OS=Mus musculus OX=10090 GN=Ptbp3 PE=1 SV=1
17	O95758	1.98e-10	67.4	552	0.026	0.058	PTBP3_HUMAN Polypyrimidine tract-binding protein 3 OS=Homo sapiens OX=9606 GN=PTBP3 PE=1 SV=2
18	Q9Z118	1.98e-10	67.4	523	0.026	0.061	PTBP3_RAT Polypyrimidine tract-binding protein 3 OS=Rattus norvegicus OX=10116 GN=Ptbp3 PE=2 SV=1
19	Q8T0H5	2.72e-09	63.5	571	0.028	0.060	Q8T0H5_DROME LD03185p OS=Drosophila melanogaster OX=7227 GN=heph PE=2 SV=1
20	A0A0B4K6W9	2.86e-09	63.9	898	0.028	0.038	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13893 RRM_5	24	16.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF12171 zf-C2H2_jaz	0.32	22.6	Zinc-finger double-stranded RNA-binding
3	PF12874 zf-met	7	18.4	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358532

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000467141	0.848	Titin
2	9606.ENSP00000401437	0.729	LIM domain-binding protein 3
3	9606.ENSP00000368341	0.714	RNA-binding protein 24
4	9606.ENSP00000309561	0.679	MICOS complex subunit MIC13
5	9606.ENSP00000479679	0.674	Enhances bone morphogenetic protein (BMP) signaling in a paracrine manner. In contrast, it inhibits both the activin-A and TGFB1-mediated signaling pathways (By similarity)
6	9606.ENSP00000442795	0.669	Myosin-binding protein C, cardiac-type
7	9606.ENSP00000236918	0.660	Troponin T, cardiac muscle
8	9606.ENSP00000358081	0.652	BAG family molecular chaperone regulator 3
9	9606.ENSP00000226382	0.628	Paired mesoderm homeobox protein 2B
10	9606.ENSP00000410257	0.620	Sodium channel protein type 5 subunit alpha
11	9606.ENSP00000261200	0.615	ATP-binding cassette sub-family C member 9
12	9606.ENSP00000347507	0.610	Myosin-7
13	9606.ENSP00000386041	0.610	Myosin-6
14	9606.ENSP00000351790	0.604	Myopalladin
15	9606.ENSP00000357283	0.604	Prelamin-A/C
16	9606.ENSP00000312624	0.585	Telethonin
17	9606.ENSP00000355533	0.585	Ryanodine receptor 2
18	9606.ENSP00000432770	0.580	Eyes absent homolog 4
19	9606.ENSP00000300738	0.579	Ribonucleoside-diphosphate reductase large subunit
20	9606.ENSP00000363071	0.579	Desmin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0097157	1.000	pre-mRNA intronic binding
GO:0005515	0.999	protein binding
GO:1990935	0.702	splicing factor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.993	regulation of cellular process
GO:0032501	0.951	multicellular organismal process
GO:0048856	0.950	anatomical structure development
GO:0048523	0.911	negative regulation of cellular process
GO:0080090	0.894	regulation of primary metabolic process
GO:0051171	0.894	regulation of nitrogen compound metabolic process
GO:0031323	0.894	regulation of cellular metabolic process
GO:0010468	0.880	regulation of gene expression
GO:0019219	0.878	regulation of nucleobase-containing compound metabolic process
GO:0048518	0.866	positive regulation of biological process
GO:0003007	0.853	heart morphogenesis
GO:0051252	0.837	regulation of RNA metabolic process
GO:0048024	0.807	regulation of mRNA splicing, via spliceosome
GO:0048645	0.774	animal organ formation
GO:0060914	0.738	heart formation
GO:0010605	0.714	negative regulation of macromolecule metabolic process
GO:0048522	0.666	positive regulation of cellular process
GO:0045934	0.620	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.608	negative regulation of RNA metabolic process
GO:0010629	0.522	negative regulation of gene expression
GO:0009987	0.482	cellular process
GO:0009893	0.433	positive regulation of metabolic process
GO:0010604	0.378	positive regulation of macromolecule metabolic process
GO:1903312	0.340	negative regulation of mRNA metabolic process
GO:0033119	0.339	negative regulation of RNA splicing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0036464	1.000	cytoplasmic ribonucleoprotein granule
GO:0070013	0.436	intracellular organelle lumen
GO:0031981	0.374	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]