StarFunc result for job id Q5T4F7

User Input

>input (317 residues)
MRAAAAGGGVRTAALALLLGALHWAPARCEEYDYYGWQAEPLHGRSYSKPPQCLDIPADL
PLCHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRP
IYPCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKI
CAQCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDT
KRLVLHMKNGAGCPCPQLDSLAGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFS
YPCSLYYPFFYGAAEPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T4F7	1.000	1.000	1.342E-65	317	1.000	1.000	Q5T4F7.pdb.gz	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
2	AFDB:Q8AWG4	0.700	0.704	2.078E-45	315	0.637	0.641	Q8AWG4.pdb.gz	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
3	AFDB:F1QJG6	0.649	0.661	1.010E-42	310	0.599	0.613	F1QJG6.pdb.gz
4	AFDB:Q8C4U3	0.711	0.718	9.221E-36	314	0.539	0.545	Q8C4U3.pdb.gz	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
5	AFDB:A0A0B5JK22	0.754	0.804	3.163E-34	296	0.454	0.486	A0A0B5JK22.pdb.gz
6	AFDB:Q7ZXM6	0.402	0.424	7.620E-33	298	0.394	0.419	Q7ZXM6.pdb.gz	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
7	AFDB:Q9IA96	0.427	0.460	1.289E-31	292	0.369	0.401	Q9IA96.pdb.gz	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
8	AFDB:B1WBV2	0.411	0.439	1.209E-30	295	0.379	0.407	B1WBV2.pdb.gz	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
9	AFDB:Q9I897	0.416	0.444	9.948E-27	295	0.363	0.390	Q9I897.pdb.gz	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
10	AFDB:Q9GUF5	0.371	0.374	2.374E-23	314	0.306	0.309	Q9GUF5.pdb.gz	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
11	PDB:1ueaB	0.222	0.363	1.682E-3	181	0.050	0.088	1ueaB.pdb.gz	Mechanism of inhibition of the human matrix metalloproteinase stromelysin-1 by TIMP-1.
12	PDB:4j15A	0.147	0.115	3.820E-2	431	0.069	0.051	4j15A.pdb.gz
13	PDB:3wxmB	0.103	0.093	6.492E-2	357	0.060	0.053	3wxmB.pdb.gz	Structural basis for mRNA surveillance by archaeal Pelota and GTP-bound EF1 alpha complex
14	PDB:1bbuA	0.169	0.116	8.716E-2	486	0.054	0.035	1bbuA.pdb.gz	Structural studies of lysyl-tRNA synthetase: conformational changes induced by substrate binding.
15	PDB:2pi2A	0.185	0.387	8.716E-2	129	0.025	0.062	2pi2A.pdb.gz
16	PDB:1u5kA	0.191	0.244	9.245E-2	242	0.035	0.045	1u5kA.pdb.gz	A Novel Structure of DNA Repair Protein RecO from Deinococcus radiodurans
17	PDB:7uy7B	0.178	0.191	1.040E-1	291	0.060	0.065	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
18	PDB:6w6wC	0.179	0.176	1.571E-1	323	0.032	0.031	6w6wC.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
19	PDB:1m4vB	0.153	0.228	1.768E-1	197	0.035	0.056	1m4vB.pdb.gz
20	PDB:3kf6B	0.160	0.357	1.989E-1	105	0.025	0.076	3kf6B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T4F7	0.0	654	317	1.000	1.000	SFRP5_HUMAN Secreted frizzled-related protein 5 OS=Homo sapiens OX=9606 GN=SFRP5 PE=2 SV=3
2	Q9WU66	0.0	572	314	0.883	0.892	SFRP5_MOUSE Secreted frizzled-related protein 5 OS=Mus musculus OX=10090 GN=Sfrp5 PE=2 SV=1
3	Q9XSC1	0.0	627	315	0.968	0.975	SFRP5_BOVIN Secreted frizzled-related protein 5 OS=Bos taurus OX=9913 GN=SFRP5 PE=2 SV=1
4	Q8AWG4	1.19e-151	429	315	0.637	0.641	Q8AWG4_XENLA Secreted frizzled-related protein 5 OS=Xenopus laevis OX=8355 GN=sfrp5.L PE=2 SV=1
5	Q6YNR8	1.42e-147	419	310	0.621	0.635	Q6YNR8_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=frp1 PE=2 SV=1
6	Q8C4U3	2.29e-108	320	314	0.511	0.516	SFRP1_MOUSE Secreted frizzled-related protein 1 OS=Mus musculus OX=10090 GN=Sfrp1 PE=1 SV=3
7	O19116	2.79e-101	301	308	0.514	0.529	SFRP1_BOVIN Secreted frizzled-related protein 1 OS=Bos taurus OX=9913 GN=SFRP1 PE=2 SV=1
8	Q8N474	3.84e-101	301	314	0.517	0.522	SFRP1_HUMAN Secreted frizzled-related protein 1 OS=Homo sapiens OX=9606 GN=SFRP1 PE=1 SV=1
9	Q7T2K9	1.85e-93	281	296	0.473	0.507	Q7T2K9_DANRE Secreted frizzled-related protein 1 OS=Danio rerio OX=7955 GN=Srfp1a PE=2 SV=1
10	Q7ZXM6	4.93e-79	244	298	0.401	0.426	Q7ZXM6_XENLA Secreted frizzled-related protein 2 S homeolog precursor OS=Xenopus laevis OX=8355 GN=sfrp2.S PE=2 SV=1
11	Q863H1	1.13e-74	233	294	0.372	0.401	SFRP2_CANLF Secreted frizzled-related protein 2 OS=Canis lupus familiaris OX=9615 GN=SFRP2 PE=2 SV=1
12	P97299	2.62e-74	232	295	0.360	0.386	SFRP2_MOUSE Secreted frizzled-related protein 2 OS=Mus musculus OX=10090 GN=Sfrp2 PE=1 SV=2
13	Q96HF1	3.36e-74	232	295	0.388	0.417	SFRP2_HUMAN Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2
14	B1WBV2	7.66e-74	231	295	0.360	0.386	B1WBV2_RAT Secreted frizzled-related protein 2 OS=Rattus norvegicus OX=10116 GN=Sfrp2 PE=3 SV=1
15	Q9IA96	2.21e-72	227	292	0.347	0.377	SFRP2_CHICK Secreted frizzled-related protein 2 OS=Gallus gallus OX=9031 GN=SFRP2 PE=2 SV=1
16	Q9I897	2.50e-68	217	295	0.338	0.363	Q9I897_XENLA Crescent OS=Xenopus laevis OX=8355 GN=frzb2.L PE=2 SV=1
17	Q9GUF5	2.01e-48	166	314	0.312	0.315	Q9GUF5_CAEEL Secreted frizzled-related protein 1 OS=Caenorhabditis elegans OX=6239 GN=sfrp-1 PE=3 SV=2
18	Q9R168	1.71e-46	156	158	0.256	0.513	SFRP1_RAT Secreted frizzled-related protein 1 (Fragment) OS=Rattus norvegicus OX=10116 GN=Sfrp1 PE=2 SV=1
19	Q7SX78	1.16e-36	134	282	0.259	0.291	Q7SX78_DANRE Sizzled OS=Danio rerio OX=7955 GN=sfrp PE=2 SV=1
20	Q61090	8.70e-25	106	572	0.167	0.093	FZD7_MOUSE Frizzled-7 OS=Mus musculus OX=10090 GN=Fzd7 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01392 Fz	1.4e-23	95.0	Fz domain
2	PF01759 NTR	1.2e-09	49.2	UNC-6/NTR/C345C module

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000266066

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264634	0.942	Protein Wnt-5a
2	9606.ENSP00000340677	0.923	Protein Wnt-8b
3	9606.ENSP00000325526	0.906	Protein Wnt-11
4	9606.ENSP00000380379	0.890	Protein Wnt-5b
5	9606.ENSP00000426653	0.889	Protein Wnt-8a
6	9606.ENSP00000358698	0.887	Protein Wnt-2b
7	9606.ENSP00000284523	0.879	Protein Wnt-3a
8	9606.ENSP00000290015	0.873	Protein Wnt-9b
9	9606.ENSP00000258411	0.872	Protein Wnt-10a
10	9606.ENSP00000225512	0.866	Proto-oncogene Wnt-3
11	9606.ENSP00000290167	0.865	Protein Wnt-4
12	9606.ENSP00000265441	0.862	Protein Wnt-2
13	9606.ENSP00000285018	0.860	Protein Wnt-7a
14	9606.ENSP00000301061	0.859	Protein Wnt-10b
15	9606.ENSP00000233948	0.858	Protein Wnt-6
16	9606.ENSP00000222462	0.853	Protein Wnt-16
17	9606.ENSP00000341032	0.843	Protein Wnt-7b
18	9606.ENSP00000293549	0.842	Proto-oncogene Wnt-1
19	9606.ENSP00000272164	0.834	Protein Wnt-9a
20	9606.ENSP00000286574	0.763	Wnt inhibitory factor 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017147	1.000	Wnt-protein binding
GO:0005102	0.429	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0048519	0.996	negative regulation of biological process
GO:0032501	0.993	multicellular organismal process
GO:0048856	0.993	anatomical structure development
GO:0009987	0.989	cellular process
GO:0048523	0.987	negative regulation of cellular process
GO:0050896	0.984	response to stimulus
GO:0030178	0.952	negative regulation of Wnt signaling pathway
GO:0007275	0.951	multicellular organism development
GO:0009888	0.919	tissue development
GO:0007267	0.912	cell-cell signaling
GO:0051716	0.905	cellular response to stimulus
GO:0007165	0.903	signal transduction
GO:0048518	0.873	positive regulation of biological process
GO:0048731	0.871	system development
GO:0019222	0.862	regulation of metabolic process
GO:0060429	0.861	epithelium development
GO:0009653	0.853	anatomical structure morphogenesis
GO:0060255	0.842	regulation of macromolecule metabolic process
GO:0007166	0.833	cell surface receptor signaling pathway
GO:0080090	0.831	regulation of primary metabolic process
GO:0044092	0.812	negative regulation of molecular function
GO:0051171	0.809	regulation of nitrogen compound metabolic process
GO:0048522	0.808	positive regulation of cellular process
GO:0031323	0.807	regulation of cellular metabolic process
GO:0010468	0.743	regulation of gene expression
GO:0050793	0.700	regulation of developmental process
GO:0010556	0.683	regulation of macromolecule biosynthetic process
GO:0031326	0.682	regulation of cellular biosynthetic process
GO:0019219	0.680	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.666	regulation of DNA-templated transcription
GO:1902531	0.648	regulation of intracellular signal transduction
GO:0016055	0.642	Wnt signaling pathway
GO:0009892	0.619	negative regulation of metabolic process
GO:0060828	0.537	regulation of canonical Wnt signaling pathway
GO:0010605	0.480	negative regulation of macromolecule metabolic process
GO:0048513	0.477	animal organ development
GO:0060070	0.472	canonical Wnt signaling pathway
GO:0031324	0.469	negative regulation of cellular metabolic process
GO:0042127	0.452	regulation of cell population proliferation
GO:0007399	0.450	nervous system development
GO:0048869	0.409	cellular developmental process
GO:1902532	0.405	negative regulation of intracellular signal transduction
GO:0030154	0.402	cell differentiation
GO:0090090	0.395	negative regulation of canonical Wnt signaling pathway
GO:0009893	0.383	positive regulation of metabolic process
GO:0010604	0.345	positive regulation of macromolecule metabolic process
GO:0051172	0.343	negative regulation of nitrogen compound metabolic process
GO:0051246	0.340	regulation of protein metabolic process
GO:0051173	0.340	positive regulation of nitrogen compound metabolic process
GO:0048584	0.324	positive regulation of response to stimulus
GO:0043408	0.314	regulation of MAPK cascade
GO:0009967	0.312	positive regulation of signal transduction
GO:0031325	0.306	positive regulation of cellular metabolic process
GO:0002009	0.305	morphogenesis of an epithelium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space
GO:0071944	0.929	cell periphery
GO:0016020	0.853	membrane
GO:0005622	0.825	intracellular anatomical structure
GO:0005737	0.743	cytoplasm
GO:0005886	0.672	plasma membrane
GO:0043227	0.557	membrane-bounded organelle
GO:0043231	0.370	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]