StarFunc result for job id Q5T4S7

User Input

>input (1400 residues)
MATSGGEEAAAAAPAPGTPATGADTTPGWEVAVRPLLSASYSAFEMKELPQLVASVIESE
SEILHHEKQYEPFYSSFVALSTHYITTVCSLIPRNQLQSVAAACKVLIEFSLLRLENPDE
ACAVSQKHLILLIKGLCTGCSRLDRTEIITFTAMMKSAKLPQTVKTLSDVEDQKELASPV
SPELRQKEVQMNFLNQLTSVFNPRTVASQPISTQTLVEGENDEQSSTDQASAIKTKNVFI
AQNVASLQELGGSEKLLRVCLNLPYFLRYINRFQDAVLANSFFIMPATVADATAVRNGFH
SLVIDVTMALDTLSLPVLEPLNPSRLQDVTVLSLSCLYAGVSVATCMAILHVGSAQQVRT
GSTSSKEDDYESDAATIVQKCLEIYDMIGQAISSSRRAGGEHYQNFQLLGAWCLLNSLFL
ILNLSPTALADKGKEKDPLAALRVRDILSRTKEGVGSPKLGPGKGHQGFGVLSVILANHA
IKLLTSLFQDLQVEALHKGWETDGPPAALSIMAQSTSIQRIQRLIDSVPLMNLLLTLLST
SYRKACVLQRQRKGSMSSDASASTDSNTYYEDDFSSTEEDSSQDDDSEPILGQWFEETIS
PSKEKAAPPPPPPPPPLESSPRVKSPSKQAPGEKGNILASRKDPELFLGLASNILNFITS
SMLNSRNNFIRNYLSVSLSEHHMATLASIIKEVDKDGLKGSSDEEFAAALYHFNHSLVTS
DLQSPNLQNTLLQQLGVAPFSEGPWPLYIHPQSLSVLSRLLLIWQHKASAQGDPDVPECL
KVWDRFLSTMKQNALQGVVPSETEDLNVEHLQMLLLIFHNFTETGRRAILSLFVQIIQEL
SVNMDAQMRFVPLILARLLLIFDYLLHQYSKAPVYLFEQVQHNLLSPPFGWASGSQDSNS
RRATTPLYHGFKEVEENWSKHFSSDAVPHPRFYCVLSPEASEDDLNRLDSVACDVLFSKL
VKYDELYAALTALLAAGSQLDTVRRKENKNVTALEACALQYYFLILWRILGILPPSKTYI
NQLSMNSPEMSECDILHTLRWSSRLRISSYVNWIKDHLIKQGMKAEHASSLLELASTTKC
SSVKYDVEIVEEYFARQISSFCSIDCTTILQLHEIPSLQSIYTLDAAISKVQVSLDEHFS
KMAAETDPHKSSEITKNLLPATLQLIDTYASFTRAYLLQNFNEEGTTEKPSKEKLQGFAA
VLAIGSSRCKANTLGPTLVQNLPSSVQTVCESWNNINTNEFPNIGSWRNAFANDTIPSES
YISAVQAAHLGTLCSQSLPLAASLKHTLLSLVRLTGDLIVWSDEMNPPQVIRTLLPLLLE
SSTESVAEISSNSLERILGPAESDEFLARVYEKLITGCYNILANHADPNSGLDESILEEC
LQYLEKQLESSQARKAMEEF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:3w3uA	0.107	0.129	8.827E-5	1030	0.114	0.155	3w3uA.pdb.gz
2	PDB:6zwmB	0.072	0.055	2.454E-4	2185	0.131	0.084	6zwmB.pdb.gz	The 3.2- angstrom resolution structure of human mTORC2.
3	PDB:7jq9A	0.139	0.102	2.826E-4	2427	0.141	0.081	7jq9A.pdb.gz
4	PDB:7mq8LM	0.076	0.061	3.141E-4	2005	0.118	0.082	7mq8LM.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	PDB:7mqaLM	0.088	0.068	3.881E-4	2041	0.125	0.086	7mqaLM.pdb.gz	Nucleolar maturation of the human small subunit processome.
6	PDB:3w3zA	0.105	0.129	4.021E-4	1013	0.111	0.154	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
7	AFDB:P43583	0.123	0.100	4.239E-4	2143	0.129	0.084	P43583.pdb.gz	BLM10_YEAST Proteasome activator BLM10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BLM10 PE=1 SV=2
8	PDB:5hb4B	0.122	0.123	4.968E-4	1388	0.144	0.145	5hb4B.pdb.gz
9	PDB:7mp6B	0.122	0.114	5.926E-4	1609	0.116	0.101	7mp6B.pdb.gz
10	PDB:7q2xD	0.101	0.124	6.138E-4	994	0.103	0.145	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
11	AFDB:Q9U2M1	0.141	0.136	6.705E-4	1499	0.116	0.109	Q9U2M1.pdb.gz	CND1_CAEEL Condensin complex subunit 1 OS=Caenorhabditis elegans OX=6239 GN=dpy-28 PE=1 SV=2
12	PDB:2xwuB	0.082	0.111	7.068E-4	910	0.087	0.134	2xwuB.pdb.gz
13	AFDB:Q9M033	0.094	0.091	8.284E-4	1467	0.115	0.110	Q9M033.pdb.gz	Q9M033_ARATH HEAT repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=ESP4 PE=1 SV=1
14	AFDB:F6NK88	0.083	0.055	3.395E-3	2552	0.121	0.067	F6NK88.pdb.gz	F6NK88_DANRE Zinc finger FYVE domain-containing protein 26 OS=Danio rerio OX=7955 GN=wu:fc33a03 PE=1 SV=1
15	AFDB:Q54F20	0.087	0.082	5.967E-3	1575	0.090	0.080	Q54F20.pdb.gz	Q54F20_DICDI Nucleoporin 155 OS=Dictyostelium discoideum OX=44689 GN=nup155 PE=4 SV=1
16	AFDB:A0A1D8PQD2	0.083	0.069	1.493E-2	2016	0.128	0.089	A0A1D8PQD2.pdb.gz	A0A1D8PQD2_CANAL CCR4-NOT core subunit OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CDC39 PE=4 SV=1
17	AFDB:D6XJQ7	0.107	0.135	1.546E-2	1015	0.088	0.121	D6XJQ7.pdb.gz	D6XJQ7_TRYB2 Conserved oligomeric Golgi complex subunit 4 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.10 PE=3 SV=1
18	AFDB:Q96N67	0.113	0.087	1.719E-2	2140	0.101	0.066	Q96N67.pdb.gz	DOCK7_HUMAN Dedicator of cytokinesis protein 7 OS=Homo sapiens OX=9606 GN=DOCK7 PE=1 SV=4
19	AFDB:Q8IIQ6	0.160	0.188	2.445E-2	1050	0.085	0.113	Q8IIQ6.pdb.gz	Q8IIQ6_PLAF7 Vacuolar protein sorting-associated protein 35 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1110500 PE=3 SV=1
20	AFDB:Q55FT4	0.089	0.066	4.006E-2	2247	0.103	0.064	Q55FT4.pdb.gz	TSUA_DICDI Probable serine/threonine-protein kinase tsuA OS=Dictyostelium discoideum OX=44689 GN=tsuA PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AN08	0.0	2624	5180	0.948	0.256	UBR4_MOUSE E3 ubiquitin-protein ligase UBR4 OS=Mus musculus OX=10090 GN=Ubr4 PE=1 SV=1
2	Q5T4S7	0.0	2880	5183	1.000	0.270	UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1
3	Q9VLT5	1.45e-95	343	5322	0.229	0.060	POE_DROME Protein purity of essence OS=Drosophila melanogaster OX=7227 GN=poe PE=1 SV=1
4	Q9C0E2	2.1	35.4	1151	0.021	0.025	XPO4_HUMAN Exportin-4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=2
5	Q0VG75	2.2	35.4	1124	0.021	0.026	Q0VG75_HUMAN Exportin 4 OS=Homo sapiens OX=9606 GN=XPO4 PE=1 SV=1
6	Q48827	4.1	33.9	297	0.016	0.074	Q48827_LEGPN Major outer membrane protein OS=Legionella pneumophila OX=446 GN=omp28 PE=4 SV=1
7	C0BK17	5.1	33.5	349	0.018	0.072	HYEP_FLABM Hydrophobic dipeptide epimerase OS=Flavobacteria bacterium (strain MS024-2A) OX=487796 GN=Flav2ADRAFT_0209 PE=3 SV=1
8	O14190	5.5	32.7	162	0.020	0.173	ALG13_SCHPO UDP-N-acetylglucosamine transferase subunit alg13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=alg13 PE=3 SV=1
9	A8MS85	6.0	33.9	1647	0.019	0.016	SPT61_ARATH Transcription elongation factor SPT6 homolog OS=Arabidopsis thaliana OX=3702 GN=SPT6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19423 E3_UBR4_N	0	2334.6	E3 ubiquitin-protein ligase UBR4 N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000364403

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386738	0.985	E3 ubiquitin-protein ligase KCMF1
2	9606.ENSP00000361990	0.864	E3 ubiquitin-protein ligase UBR2
3	9606.ENSP00000382269	0.855	E3 ubiquitin-protein ligase HECTD1
4	9606.ENSP00000348965	0.853	Cytoplasmic dynein 1 heavy chain 1
5	9606.ENSP00000290650	0.835	E3 ubiquitin-protein ligase UBR1
6	9606.ENSP00000393596	0.806	Baculoviral IAP repeat-containing protein 6
7	9606.ENSP00000224652	0.796	Arginyl-tRNA--protein transferase 1
8	9606.ENSP00000316357	0.777	Probable ubiquitin carboxyl-terminal hydrolase FAF-X
9	9606.ENSP00000013070	0.740	Putative E3 ubiquitin-protein ligase UBR7
10	9606.ENSP00000349467	0.740	Calmodulin-1
11	9606.ENSP00000340648	0.731	E3 ubiquitin-protein ligase HUWE1
12	9606.ENSP00000396068	0.728	E3 ubiquitin-protein ligase UBR3
13	9606.ENSP00000420608	0.723	ER membrane protein complex subunit 1
14	9606.ENSP00000301067	0.700	Histone-lysine N-methyltransferase 2D
15	9606.ENSP00000315768	0.700	Signal transducer and activator of transcription 2
16	9606.ENSP00000366170	0.690	Cystatin-9
17	9606.ENSP00000265339	0.687	Ubiquitin-conjugating enzyme E2 B
18	9606.ENSP00000360613	0.679	Ubiquitin-conjugating enzyme E2 A
19	9606.ENSP00000362532	0.677	Regulation of nuclear pre-mRNA domain-containing protein 1B
20	9606.ENSP00000297904	0.676	Vascular endothelial growth factor D

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0004842	0.501	ubiquitin-protein transferase activity
GO:0061630	0.429	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051603	0.938	proteolysis involved in protein catabolic process
GO:0006511	0.933	ubiquitin-dependent protein catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043232	0.999	intracellular non-membrane-bounded organelle
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.991	membrane
GO:0012505	0.987	endomembrane system
GO:0031982	0.980	vesicle
GO:0005634	0.979	nucleus
GO:0005654	0.968	nucleoplasm
GO:0031410	0.957	cytoplasmic vesicle
GO:0005856	0.954	cytoskeleton
GO:0071944	0.947	cell periphery
GO:0005886	0.889	plasma membrane
GO:0005813	0.880	centrosome
GO:0030141	0.878	secretory granule
GO:0030659	0.877	cytoplasmic vesicle membrane
GO:0098588	0.873	bounding membrane of organelle
GO:0101003	0.864	ficolin-1-rich granule membrane
GO:0042581	0.861	specific granule
GO:0070821	0.861	tertiary granule membrane
GO:0035579	0.848	specific granule membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.503	Transferases.

[back to server]