StarFunc result for job id Q5T4T1

User Input

>input (132 residues)
MKAEGGDHSMINLSVQQVLSLWAHGTVLRNLTEMWYWIFLWALFSSLFVHGAAGVLMFVM
LQRHRQGRVISVIAVSIGFLASVTGAMITSAAVAGIYRVAGKNMAPLEALVWGVGQTVLT
LIISFSRILATL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T4T1	1.000	1.000	3.283E-20	132	1.000	1.000	Q5T4T1.pdb.gz	T170B_HUMAN Transmembrane protein 170B OS=Homo sapiens OX=9606 GN=TMEM170B PE=1 SV=1
2	AFDB:Q8WVE7	0.769	0.707	3.921E-10	144	0.492	0.451	Q8WVE7.pdb.gz	T170A_HUMAN Transmembrane protein 170A OS=Homo sapiens OX=9606 GN=TMEM170A PE=1 SV=1
3	AFDB:P75916	0.275	0.230	1.192	163	0.106	0.086	P75916.pdb.gz	YCDZ_ECOLI Inner membrane protein YcdZ OS=Escherichia coli (strain K12) OX=83333 GN=ycdZ PE=1 SV=2
4	AFDB:P9WHR9	0.302	0.134	2.161	397	0.182	0.060	P9WHR9.pdb.gz	Y3671_MYCTU Serine protease Rv3671c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3671c PE=1 SV=1
5	AFDB:P08550	0.415	0.345	2.583	162	0.114	0.093	P08550.pdb.gz	CVPA_ECOLI Colicin V production protein OS=Escherichia coli (strain K12) OX=83333 GN=cvpA PE=1 SV=1
6	AFDB:Q9BSE2	0.160	0.074	2.910	394	0.212	0.071	Q9BSE2.pdb.gz	TMM79_HUMAN Transmembrane protein 79 OS=Homo sapiens OX=9606 GN=TMEM79 PE=1 SV=1
7	AFDB:Q2HIU0	0.237	0.147	3.277	266	0.106	0.053	Q2HIU0.pdb.gz	Q2HIU0_ARATH At3g15110 OS=Arabidopsis thaliana OX=3702 GN=At3g15110 PE=1 SV=1
8	AFDB:Q9S756	0.282	0.162	3.277	259	0.121	0.062	Q9S756.pdb.gz	FRI4_ARATH Ferritin-4, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=FER4 PE=2 SV=1
9	PDB:7ot9A	0.200	0.153	3.883	221	0.189	0.113	7ot9A.pdb.gz
10	AFDB:P38956	0.289	0.239	3.918	169	0.106	0.083	P38956.pdb.gz	SNF11_YEAST Transcription regulatory protein SNF11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SNF11 PE=1 SV=1
11	PDB:6lo8A	0.191	0.195	4.373	129	0.129	0.132	6lo8A.pdb.gz
12	PDB:6wtiC	0.260	0.202	4.373	186	0.212	0.151	6wtiC.pdb.gz	A 'Build and Retrieve' methodology to simultaneously solve cryo-EM structures of membrane proteins.
13	AFDB:Q57X63	0.196	0.143	4.413	193	0.106	0.073	Q57X63.pdb.gz	Q57X63_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.26A24.930 PE=4 SV=1
14	PDB:4hfcA	0.142	0.066	4.926	311	0.091	0.039	4hfcA.pdb.gz	Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
15	PDB:7ungB0	0.236	0.181	5.228	193	0.091	0.062	7ungB0.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
16	PDB:2yvxA	0.362	0.128	5.548	442	0.205	0.061	2yvxA.pdb.gz	Crystal structure of the MgtE Mg(2+) transporter
17	PDB:7siiA	0.198	0.102	5.888	324	0.129	0.052	7siiA.pdb.gz	Activation of STING by targeting a pocket in the transmembrane domain.
18	PDB:6nt5A	0.185	0.112	6.632	292	0.083	0.038	6nt5A.pdb.gz
19	PDB:3zk1A	0.280	0.379	7.470	89	0.091	0.135	3zk1A.pdb.gz	A New Type of Na(+)-Driven ATP Synthase Membrane Rotor with a Two-Carboxylate Ion-Coupling Motif.
20	PDB:5u1dB	0.230	0.088	7.470	552	0.091	0.022	5u1dB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T4T1	2.31e-90	259	132	1.000	1.000	T170B_HUMAN Transmembrane protein 170B OS=Homo sapiens OX=9606 GN=TMEM170B PE=1 SV=1
2	Q8WVE7	3.77e-33	115	144	0.477	0.438	T170A_HUMAN Transmembrane protein 170A OS=Homo sapiens OX=9606 GN=TMEM170A PE=1 SV=1
3	Q5I012	1.6	30.8	1090	0.129	0.016	S38AA_MOUSE Solute carrier family 38 member 10 OS=Mus musculus OX=10090 GN=Slc38a10 PE=1 SV=2
4	P39210	7.5	28.1	176	0.068	0.051	MPV17_HUMAN Protein Mpv17 OS=Homo sapiens OX=9606 GN=MPV17 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02595 Gly_kinase	1.1e+02	13.2	Glycerate kinase family
2	PF10190 Tmemb_170	8.5e-34	127.5	Putative transmembrane protein 170

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9612.ENSCAFP00000039270

Rank	PPI partner	STRING score	Description
1	9612.ENSCAFP00000035918	0.693	V-set and transmembrane domain containing 4
2	9612.ENSCAFP00000017044	0.514	Rho GTPase activating protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.989	regulation of cellular process
GO:0048523	0.984	negative regulation of cellular process
GO:0030111	0.905	regulation of Wnt signaling pathway
GO:0009968	0.897	negative regulation of signal transduction
GO:0030178	0.872	negative regulation of Wnt signaling pathway
GO:0060828	0.869	regulation of canonical Wnt signaling pathway
GO:0090090	0.857	negative regulation of canonical Wnt signaling pathway
GO:0009987	0.445	cellular process
GO:0071840	0.342	cellular component organization or biogenesis
GO:0016043	0.328	cellular component organization
GO:0022607	0.317	cellular component assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.996	plasma membrane
GO:0043226	0.419	organelle
GO:0043229	0.401	intracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]