StarFunc result for job id Q5T5C0

User Input

>input (1151 residues)
MRKFNIRKVLDGLTAGSSSASQQQQQQHPPGNREPEIQETLQSEHFQLCKTVRHGFPYQP
SALAFDPVQKILAVGTQTGALRLFGRPGVECYCQHDSGAAVIQLQFLINEGALVSALADD
TLHLWNLRQKRPAILHSLKFCRERVTFCHLPFQSKWLYVGTERGNIHIVNVESFTLSGYV
IMWNKAIELSSKSHPGPVVHISDNPMDEGKLLIGFESGTVVLWDLKSKKADYRYTYDEAI
HSVAWHHEGKQFICSHSDGTLTIWNVRSPAKPVQTITPHGKQLKDGKKPEPCKPILKVEF
KTTRSGEPFIILSGGLSYDTVGRRPCLTVMHGKSTAVLEMDYSIVDFLTLCETPYPNDFQ
EPYAVVVLLEKDLVLIDLAQNGYPIFENPYPLSIHESPVTCCEYFADCPVDLIPALYSVG
ARQKRQGYSKKEWPINGGNWGLGAQSYPEIIITGHADGSVKFWDASAITLQVLYKLKTSK
VFEKSRNKDDRPNTDIVDEDPYAIQIISWCPESRMLCIAGVSAHVIIYRFSKQEVITEVI
PMLEVRLLYEINDVETPEGEQPPPLPTPVGGSNPQPIPPQSHPSTSSSSSDGLRDNVPCL
KVKNSPLKQSPGYQTELVIQLVWVGGEPPQQITSLAVNSSYGLVVFGNCNGIAMVDYLQK
AVLLNLGTIELYGSNDPYRREPRSPRKSRQPSGAGLCDISEGTVVPEDRCKSPTSGSSSP
HNSDDEQKMNNFIEKVKTKSRKFSKMVANDIAKMSRKLSLPTDLKPDLDVKDNSFSRSRS
SSVTSIDKESREAISALHFCETFTRKTDSSPSPCLWVGTTLGTVLVIALNLPPGGEQRLL
QPVIVSPSGTILRLKGAILRMAFLDTTGCLIPPAYEPWREHNVPEEKDEKEKLKKRRPVS
VSPSSSQEISENQYAVICSEKQAKVISLPTQNCAYKQNITETSFVLRGDIVALSNSICLA
CFCANGHIMTFSLPSLRPLLDVYYLPLTNMRIARTFCFTNNGQALYLVSPTEIQRLTYSQ
ETCENLQEMLGELFTPVETPEAPNRGFFKGLFGGGAQSLDREELFGESSSGKASRSLAQH
IPGPGGIEGVKGAASGVVGELARARLALDERGQKLGDLEERTAAMLSSAESFSKHAHEIM
LKYKDKKWYQF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A4V4D2	0.767	0.705	0.000	1254	0.452	0.415	A4V4D2.pdb.gz	A4V4D2_DROME Tomosyn, isoform H OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=1
2	AFDB:Q8K400	0.870	0.870	0.000	1152	0.967	0.966	Q8K400.pdb.gz	STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus OX=10090 GN=Stxbp5 PE=1 SV=3
3	AFDB:Q9VYK6	0.762	0.601	0.000	1470	0.463	0.363	Q9VYK6.pdb.gz	Q9VYK6_DROME Tomosyn, isoform C OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=3
4	AFDB:Q9Y2K9	0.837	0.814	0.000	1186	0.669	0.649	Q9Y2K9.pdb.gz	STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens OX=9606 GN=STXBP5L PE=1 SV=2
5	AFDB:G5EE26	0.737	0.748	1.052E-101	1133	0.340	0.345	G5EE26.pdb.gz	G5EE26_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
6	AFDB:A0A0K3ATN9	0.729	0.671	1.576E-98	1255	0.349	0.320	A0A0K3ATN9.pdb.gz	A0A0K3ATN9_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
7	AFDB:Q49HI2	0.633	0.687	1.487E-86	1058	0.312	0.339	Q49HI2.pdb.gz	Q49HI2_CAEEL Tomosyn OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=2 SV=1
8	AFDB:E7FD67	0.636	0.701	5.444E-76	1040	0.239	0.264	E7FD67.pdb.gz	E7FD67_DANRE LLGL scribble cell polarity complex component 1 OS=Danio rerio OX=7955 GN=zgc:153337 PE=1 SV=3
9	AFDB:Q15334	0.638	0.687	4.366E-75	1064	0.236	0.256	Q15334.pdb.gz	L2GL1_HUMAN Lethal(2) giant larvae protein homolog 1 OS=Homo sapiens OX=9606 GN=LLGL1 PE=1 SV=3
10	AFDB:Q3TJ91	0.608	0.678	6.230E-75	1027	0.240	0.269	Q3TJ91.pdb.gz	L2GL2_MOUSE LLGL scribble cell polarity complex component 2 OS=Mus musculus OX=10090 GN=Llgl2 PE=1 SV=2
11	PDB:6n8sA	0.598	0.811	4.232E-71	834	0.224	0.309	6n8sA.pdb.gz
12	PDB:7d5sB2	0.317	0.400	4.315E-17	851	0.080	0.108	7d5sB2.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
13	PDB:7mq8LR	0.353	0.488	4.315E-17	773	0.078	0.116	7mq8LR.pdb.gz	Nucleolar maturation of the human small subunit processome.
14	PDB:7mq8LT	0.389	0.494	5.025E-17	869	0.074	0.098	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
15	PDB:6nd4Q	0.310	0.385	2.824E-16	862	0.081	0.108	6nd4Q.pdb.gz	Conformational switches control early maturation of the eukaryotic small ribosomal subunit.
16	PDB:7mqaLQ	0.339	0.439	4.693E-16	830	0.083	0.114	7mqaLQ.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7ajuUL	0.325	0.439	1.670E-15	779	0.083	0.122	7ajuUL.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
18	PDB:7d5sBE	0.290	0.359	1.757E-15	865	0.093	0.124	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
19	PDB:7mq8LO	0.142	0.189	1.273E-14	848	0.063	0.085	7mq8LO.pdb.gz	Nucleolar maturation of the human small subunit processome.
20	PDB:7mqaLO	0.143	0.197	1.273E-14	819	0.061	0.085	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A4V4D2	0.0	691	1254	0.300	0.275	A4V4D2_DROME Tomosyn, isoform H OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=1
2	G5EE26	0.0	674	1133	0.356	0.362	G5EE26_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
3	Q14DX2	0.0	674	1128	0.355	0.363	Q14DX2_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
4	Q49HI3	0.0	682	1124	0.356	0.365	Q49HI3_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
5	Q5DQR4	0.0	1561	1185	0.660	0.641	STB5L_MOUSE Syntaxin-binding protein 5-like OS=Mus musculus OX=10090 GN=Stxbp5l PE=1 SV=1
6	Q5T5C0	0.0	2386	1151	1.000	1.000	STXB5_HUMAN Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5 PE=1 SV=1
7	Q8K400	0.0	2325	1152	0.970	0.969	STXB5_MOUSE Syntaxin-binding protein 5 OS=Mus musculus OX=10090 GN=Stxbp5 PE=1 SV=3
8	Q9VYK5	0.0	691	1387	0.298	0.247	Q9VYK5_DROME Tomosyn, isoform K OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=4
9	Q9VYK6	0.0	694	1470	0.305	0.239	Q9VYK6_DROME Tomosyn, isoform C OS=Drosophila melanogaster OX=7227 GN=Tomosyn PE=1 SV=3
10	Q9WU70	0.0	2321	1152	0.970	0.969	STXB5_RAT Syntaxin-binding protein 5 OS=Rattus norvegicus OX=10116 GN=Stxbp5 PE=1 SV=1
11	Q9Y2K9	0.0	1566	1186	0.666	0.647	STB5L_HUMAN Syntaxin-binding protein 5-like OS=Homo sapiens OX=9606 GN=STXBP5L PE=1 SV=2
12	A0A0K3AWL6	3.70e-159	508	1250	0.221	0.203	A0A0K3AWL6_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
13	A0A0K3ATN9	5.53e-159	508	1255	0.221	0.202	A0A0K3ATN9_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
14	A0A0K3AR90	7.32e-159	507	1246	0.221	0.204	A0A0K3AR90_CAEEL Lethal giant larvae homologue 2 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=1 SV=1
15	Q49HI2	5.93e-136	441	1058	0.188	0.204	Q49HI2_CAEEL Tomosyn OS=Caenorhabditis elegans OX=6239 GN=tom-1 PE=2 SV=1
16	E7FD67	3.11e-107	363	1040	0.254	0.281	E7FD67_DANRE LLGL scribble cell polarity complex component 1 OS=Danio rerio OX=7955 GN=zgc:153337 PE=1 SV=3
17	Q3TJ91	1.74e-106	360	1027	0.255	0.286	L2GL2_MOUSE LLGL scribble cell polarity complex component 2 OS=Mus musculus OX=10090 GN=Llgl2 PE=1 SV=2
18	I0BWE2	1.75e-105	358	1040	0.252	0.279	I0BWE2_DANRE Lethal giant larvae 1 OS=Danio rerio OX=7955 GN=zgc:153337 PE=1 SV=1
19	Q7SZE3	3.03e-100	343	1020	0.242	0.273	L2GL2_DANRE LLGL scribble cell polarity complex component 2 OS=Danio rerio OX=7955 GN=llgl2 PE=1 SV=1
20	Q6P1M3	6.46e-97	334	1020	0.177	0.200	L2GL2_HUMAN LLGL scribble cell polarity complex component 2 OS=Homo sapiens OX=9606 GN=LLGL2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12894 ANAPC4_WD40	1.4e-07	43.0	Anaphase-promoting complex subunit 4 WD40 domain
2	PF16687 ELYS-bb	1.8e+02	12.2	beta-propeller of ELYS nucleoporin
3	PF11768 Frtz	5.6e+02	10.2	WD repeat-containing and planar cell polarity effector protein Fritz
4	PF08596 Lgl_C	0.00053	30.4	Lethal giant larvae(Lgl) like, C-terminal
5	PF08366 LLGL	7.4e-30	114.6	LLGL2
6	PF14655 RAB3GAP2_N	18	15.9	Rab3 GTPase-activating protein regulatory subunit N-terminus
7	PF00957 Synaptobrevin	4.8	18.4	Synaptobrevin
8	PF00400 WD40	4.3e-05	35.4	WD domain, G-beta repeat
9	PF17005 WD40_like	45	14.8	WD40-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000321826

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000222812	0.997	Syntaxin-1A
2	9606.ENSP00000254976	0.993	Synaptosomal-associated protein 25
3	9606.ENSP00000215095	0.952	Syntaxin-1B
4	9606.ENSP00000317714	0.951	Syntaxin-4
5	9606.ENSP00000249647	0.940	Synaptosomal-associated protein 23
6	9606.ENSP00000215730	0.924	Synaptosomal-associated protein 29
7	9606.ENSP00000258301	0.919	Syntaxin-6
8	9606.ENSP00000338562	0.916	Syntaxin-3
9	9606.ENSP00000356918	0.905	Syntaxin-7
10	9606.ENSP00000450731	0.895	Vesicle transport through interaction with t-SNAREs homolog 1B
11	9606.ENSP00000314214	0.885	Vesicle-associated membrane protein 2
12	9606.ENSP00000356540	0.884	Syntaxin-11
13	9606.ENSP00000363054	0.868	Syntaxin-12
14	9606.ENSP00000376792	0.856	Vesicle transport through interaction with t-SNAREs homolog 1A
15	9606.ENSP00000263864	0.842	Vesicle-associated membrane protein 8
16	9606.ENSP00000294179	0.834	Syntaxin-5
17	9606.ENSP00000263354	0.833	Alpha-soluble NSF attachment protein
18	9606.ENSP00000376178	0.819	Syntaxin-2
19	9606.ENSP00000305613	0.813	Complexin-1
20	9606.ENSP00000407118	0.812	Syntabulin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0017075	0.995	syntaxin-1 binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0050794	0.993	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0017157	0.953	regulation of exocytosis
GO:0051179	0.856	localization
GO:0051234	0.847	establishment of localization
GO:0006810	0.834	transport
GO:0016192	0.720	vesicle-mediated transport
GO:0071840	0.503	cellular component organization or biogenesis
GO:0016043	0.434	cellular component organization
GO:0051641	0.403	cellular localization
GO:0048518	0.361	positive regulation of biological process
GO:0051649	0.344	establishment of localization in cell
GO:0048522	0.330	positive regulation of cellular process
GO:0065008	0.308	regulation of biological quality

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005737	0.999	cytoplasm
GO:0071944	0.995	cell periphery
GO:0012505	0.994	endomembrane system
GO:0043231	0.990	intracellular membrane-bounded organelle
GO:0005829	0.988	cytosol
GO:0005886	0.957	plasma membrane
GO:0030054	0.950	cell junction
GO:0031982	0.834	vesicle
GO:0031410	0.818	cytoplasmic vesicle
GO:0031090	0.800	organelle membrane
GO:0045202	0.782	synapse
GO:0098588	0.737	bounding membrane of organelle
GO:0099503	0.721	secretory vesicle
GO:0030141	0.666	secretory granule
GO:0098793	0.594	presynapse
GO:0032991	0.570	protein-containing complex
GO:0030659	0.487	cytoplasmic vesicle membrane
GO:0098796	0.427	membrane protein complex
GO:0019898	0.384	extrinsic component of membrane
GO:1903561	0.326	extracellular vesicle
GO:0098590	0.324	plasma membrane region
GO:0070062	0.301	extracellular exosome
GO:0043232	0.300	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]