StarFunc result for job id Q5T5J6

User Input

>input (900 residues)
MSSKESCGKKETSQRKDTTTSSPNFGEKDKKERKTPASSTSSSSIRSVSSEKRKLKSDHT
DVLYYNIKRRQGLKRLSVEIDTLRRRPKIGSSSQRPIKLKEASYSNDNQIILQSPSSNGT
KKDIHKCVDFKPKDIKLTNAGSKLDHGIKSLSSPKIASDVKPKAEGQASENKWSHLLVQR
EKMKELKKGRNSKFRDNSEKCVLEKWKRNQFSQDYNSNKIIKEPLGSRRQKISFKIPIKS
RDTLQKLVEENVFNIDSNNSKTKQEEREYLESSQVSLNVTRQKTEHLLSDFTYKRTVHEW
KRKHHYDHQESNDSHSRENLTQSFEAPCCSVSSESIQDADQEMQIVEELHAARVGKSVDL
PGELMSMEIDLEDDVHSSSANNTSDRKLLIVIDTNILMNHLKFVRILKTTEVPGFDKLVL
IIPWVVMQELDRMKEGKLLKRAQHKAIPAVHFINDSLKNQDRKLWGQSIQLASQKHYGLS
DENNDDRVLKCCLQHQELFPCSFVILCTDDRNLRNKGLISGVKSLSKEELSAELLHLSLN
TDVCHQPCIPKQQLKAETTPLKESYKEESTNSGLSILLESIVSDLEKSLGTGLSSILETE
MKIAFGNLWMEILYLKPPWTLLHLLQCFKKHWLAVFGLVMEKNLLLTIESLYKNLRKANK
AVDFTTVKFLLQDSRSLLHAFSTRSNYDGILPQTFAQVNNLLQTFAEVKTKLKPNSSENT
VTKKQEGTSLKNSHNQEITVFSSSHLPQPSRHQEIWSILESVWITIYQNSTDVFQRLGSN
SALTTSNIASFEEAFICLQKLMAAVRDILEGIQRILAPNSNYQDVETLYNFLIKYEVNKN
VKFTAQEIYDCVSQTEYREKLTIGCRQLVEMEYTMQQCNASVYMEAKNRGWCEDMLNYRI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B7SY83	0.159	0.100	2.021E-7	1477	0.123	0.075	B7SY83.pdb.gz	PS1_ARATH FHA domain-containing protein PS1 OS=Arabidopsis thaliana OX=3702 GN=PS1 PE=2 SV=1
2	PDB:4ifdJ	0.128	0.122	4.165E-4	948	0.033	0.032	4ifdJ.pdb.gz	Crystal structure of an RNA-bound 11-subunit eukaryotic exosome complex.
3	PDB:6h25J	0.126	0.130	4.165E-4	868	0.030	0.031	6h25J.pdb.gz	Distinct and evolutionary conserved structural features of the human nuclear exosome complex.
4	AFDB:Q8TER5	0.059	0.042	4.591E-4	1519	0.118	0.070	Q8TER5.pdb.gz	ARH40_HUMAN Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40 PE=1 SV=3
5	AFDB:P34333	0.071	0.044	5.740E-4	1778	0.130	0.066	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
6	PDB:5c0wJ	0.127	0.119	7.784E-4	970	0.039	0.036	5c0wJ.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
7	AFDB:B0M0P8	0.061	0.037	3.584E-3	2356	0.137	0.052	B0M0P8.pdb.gz	GEFL_DICDI Ras guanine nucleotide exchange factor L OS=Dictyostelium discoideum OX=44689 GN=gefL PE=2 SV=1
8	AFDB:X2JAX8	0.058	0.043	5.603E-3	1330	0.123	0.083	X2JAX8.pdb.gz	X2JAX8_DROME Nostrin, isoform H OS=Drosophila melanogaster OX=7227 GN=Nost PE=1 SV=1
9	AFDB:Q54J96	0.055	0.041	8.009E-3	1476	0.154	0.094	Q54J96.pdb.gz	Q54J96_DICDI Enhancer of mRNA-decapping protein 4 WD40 repeat region domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0288241 PE=4 SV=1
10	AFDB:O54988	0.054	0.041	2.140E-2	1233	0.124	0.091	O54988.pdb.gz	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
11	AFDB:F1NW90	0.083	0.088	3.825E-2	823	0.114	0.125	F1NW90.pdb.gz	F1NW90_CHICK Neural precursor cell expressed, developmentally down-regulated 9 OS=Gallus gallus OX=9031 GN=NEDD9 PE=3 SV=4
12	PDB:7mq8SL	0.100	0.376	4.744E-2	192	0.036	0.167	7mq8SL.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:7d5s5K	0.098	0.415	4.960E-2	175	0.040	0.206	7d5s5K.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)
14	AFDB:Q9NQ75	0.063	0.071	6.253E-2	786	0.104	0.120	Q9NQ75.pdb.gz	CASS4_HUMAN Cas scaffolding protein family member 4 OS=Homo sapiens OX=9606 GN=CASS4 PE=1 SV=2
15	PDB:7kzvV	0.084	0.074	7.091E-2	1155	0.070	0.055	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
16	PDB:7ay1A	0.100	0.091	8.108E-2	1033	0.076	0.066	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
17	AFDB:A0A0B4KFL4	0.073	0.073	8.175E-2	882	0.110	0.112	A0A0B4KFL4.pdb.gz	A0A0B4KFL4_DROME Rfx, isoform F OS=Drosophila melanogaster OX=7227 GN=Rfx PE=4 SV=1
18	PDB:3dboB	0.100	0.560	3.872E-1	126	0.016	0.111	3dboB.pdb.gz
19	PDB:6yxyBA	0.123	0.141	3.872E-1	769	0.052	0.061	6yxyBA.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
20	PDB:4o9yA	0.047	0.024	4.049E-1	2490	0.066	0.024	4o9yA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9P7J1	3.29e-11	68.9	465	0.051	0.099	SWT1_SCHPO Transcriptional protein swt1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=swt1 PE=3 SV=2
2	Q12104	2.38e-09	63.2	458	0.073	0.144	SWT1_YEAST Transcriptional protein SWT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SWT1 PE=1 SV=1
3	Q86US8	2.86e-09	63.5	1419	0.056	0.035	EST1A_HUMAN Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2
4	A0A0R4IZ84	9.37e-09	62.0	1544	0.052	0.030	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
5	Q86BS8	1.7	35.0	949	0.049	0.046	Q86BS8_DROME SMG6 protein OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
6	Q8MZI0	3.9	33.5	688	0.050	0.065	Q8MZI0_DROME GM14040p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=1
7	O94318	4.1	32.7	226	0.019	0.075	VPS20_SCHPO Vacuolar protein sorting-associated protein 20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=vps20 PE=3 SV=1
8	Q9ZUU9	5.8	33.1	730	0.027	0.033	AB3G_ARATH ABC transporter G family member 3 OS=Arabidopsis thaliana OX=3702 GN=ABCG3 PE=1 SV=2
9	Q9VBZ6	6.9	32.7	948	0.048	0.045	Q9VBZ6_DROME GH14566p OS=Drosophila melanogaster OX=7227 GN=Smg6 PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19754 DUF6241	2.7e+02	13.2	Family of unknown function (DUF6241)
2	PF13638 PIN_4	6e-23	93.0	PIN domain
3	PF18477 PIN_9	4.9e+02	12.3	PIN like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356470

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356476	0.760	TRMT1-like protein
2	9606.ENSP00000356468	0.708	Influenza virus NS1A-binding protein
3	9606.ENSP00000355261	0.699	Protein SMG5
4	9606.ENSP00000366997	0.608	Exosome complex exonuclease RRP44
5	9606.ENSP00000245838	0.589	THO complex subunit 2
6	9606.ENSP00000230640	0.564	Superkiller viralicidic activity 2-like 2
7	9606.ENSP00000355512	0.547	Opsin-3
8	9606.ENSP00000296215	0.546	Smad nuclear-interacting protein 1
9	9606.ENSP00000355523	0.536	Regulator of G-protein signaling 7
10	9606.ENSP00000366396	0.535	5'-3' exoribonuclease 2
11	9606.ENSP00000264951	0.519	5'-3' exoribonuclease 1
12	9606.ENSP00000356480	0.513	E3 ubiquitin-protein ligase RING2
13	9606.ENSP00000268802	0.508	RNA-binding protein NOB1
14	9606.ENSP00000371155	0.502	Nucleoporin p58/p45

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140098	0.997	catalytic activity, acting on RNA
GO:0004518	0.991	nuclease activity
GO:0004540	0.983	ribonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043170	0.997	macromolecule metabolic process
GO:0006139	0.995	nucleobase-containing compound metabolic process
GO:0048519	0.988	negative regulation of biological process
GO:0016070	0.988	RNA metabolic process
GO:0060255	0.978	regulation of macromolecule metabolic process
GO:0044260	0.941	cellular macromolecule metabolic process
GO:0010468	0.846	regulation of gene expression
GO:0009892	0.728	negative regulation of metabolic process
GO:0010605	0.685	negative regulation of macromolecule metabolic process
GO:0044270	0.676	cellular nitrogen compound catabolic process
GO:0046700	0.675	heterocycle catabolic process
GO:0034655	0.668	nucleobase-containing compound catabolic process
GO:0050794	0.619	regulation of cellular process
GO:0080090	0.588	regulation of primary metabolic process
GO:0016071	0.578	mRNA metabolic process
GO:0051171	0.567	regulation of nitrogen compound metabolic process
GO:0044265	0.564	cellular macromolecule catabolic process
GO:0031323	0.558	regulation of cellular metabolic process
GO:0010467	0.516	gene expression
GO:0010629	0.437	negative regulation of gene expression
GO:0006401	0.436	RNA catabolic process
GO:0000956	0.364	nuclear-transcribed mRNA catabolic process
GO:0019219	0.346	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.997	cytoplasm
GO:0005829	0.994	cytosol
GO:0016020	0.699	membrane
GO:0043232	0.385	intracellular non-membrane-bounded organelle
GO:0016604	0.378	nuclear body
GO:0032991	0.362	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.1.-.-	0.994	Acting on ester bonds.

[back to server]