StarFunc result for job id Q5T5P2

User Input

>input (1943 residues)
MEENESQKCEPCLPYSADRRQMQEQGKGNLHVTSPEDAECRRTKERLSNGNSRGSVSKSS
RNIPRRHTLGGPRSSKEILGMQTSEMDRKREAFLEHLKQKYPHHASAIMGHQERLRDQTR
SPKLSHSPQPPSLGDPVEHLSETSADSLEAMSEGDAPTPFSRGSRTRASLPVVRSTNQTK
ERSLGVLYLQYGDETKQLRMPNEITSADTIRALFVSAFPQQLTMKMLESPSVAIYIKDES
RNVYYELNDVRNIQDRSLLKVYNKDPAHAFNHTPKTMNGDMRMQRELVYARGDGPGAPRP
GSTAHPPHAIPNSPPSTPVPHSMPPSPSRIPYGGTRSMVVPGNATIPRDRISSLPVSRPI
SPSPSAILERRDVKPDEDMSGKNIAMYRNEGFYADPYLYHEGRMSIASSHGGHPLDVPDH
IIAYHRTAIRSASAYCNPSMQAEMHMEQSLYRQKSRKYPDSHLPTLGSKTPPASPHRVSD
LRMIDMHAHYNAHGPPHTMQPDRASPSRQAFKKEPGTLVYIEKPRSAAGLSSLVDLGPPL
MEKQVFAYSTATIPKDRETRERMQAMEKQIASLTGLVQSALFKGPITSYSKDASSEKMMK
TTANRNHTDSAGTPHVSGGKMLSALESTVPPSQPPPVGTSAIHMSLLEMRRSVAELRLQL
QQMRQLQLQNQELLRAMMKKAELEISGKVMETMKRLEDPVQRQRVLVEQERQKYLHEEEK
IVKKLCELEDFVEDLKKDSTAASRLVTLKDVEDGAFLLRQVGEAVATLKGEFPTLQNKMR
AILRIEVEAVRFLKEEPHKLDSLLKRVRSMTDVLTMLRRHVTDGLLKGTDAAQAAQYMAM
EKATAAEVLKSQEEAAHTSGQPFHSTGAPGDAKSEVVPLSGMMVRHAQSSPVVIQPSQHS
VALLNPAQNLPHVASSPAVPQEATSTLQMSQAPQSPQIPMNGSAMQSLFIEEIHSVSAKN
RAVSIEKAEKKWEEKRQNLDHYNGKEFEKLLEEAQANIMKSIPNLEMPPATGPLPRGDAP
VDKVELSEDSPNSEQDLEKLGGKSPPPPPPPPRRSYLPGSGLTTTRSGDVVYTGRKENIT
AKASSEDAGPSPQTRATKYPAEEPASAWTPSPPPVTTSSSKDEEEEEEEGDKIMAELQAF
QKCSFMDVNSNSHAEPSRADSHVKDTRSGATVPPKEKKNLEFFHEDVRKSDVEYENGPQM
EFQKVTTGAVRPSDPPKWERGMENSISDASRTSEYKTEIIMKENSISNMSLLRDSRNYSQ
ETVPKASFGFSGISPLEDEINKGSKISGLQYSIPDTENQTLNYGKTKEMEKQNTDKCHVS
SHTRLTESSVHDFKTEDQEVITTDFGQVVLRPKEARHANVNPNEDGESSSSSPTEENAAT
DNIAFMITETTVQVLSSGEVHDIVSQKGEDIQTVNIDARKEMTPRQEGTDNEDPVVCLDK
KPVIIIFDEPMDIRSAYKRLSTIFEECDEELERMMMEEKIEEEEEEENGDSVVQNNNTSQ
MSHKKVAPGNLRTGQQVETKSQPHSLATETRNPGGQEMNRTELNKFSHVDSPNSECKGED
ATDDQFESPKKKFKFKFPKKQLAALTQAIRTGTKTGKKTLQVVVYEEEEEDGTLKQHKEA
KRFEIARSQPEDTPENTVRRQEQPSIESTSPISRTDEIRKNTYRTLDSLEQTIKQLENTI
SEMSPKALVDTSCSSNRDSVASSSHIAQEASPRPLLVPDEGPTALEPPTSIPSASRKGSS
GAPQTSRMPVPMSAKNRPGTLDKPGKQSKLQDPRQYRQANGSAKKSGGDFKPTSPSLPAS
KIPALSPSSGKSSSLPSSSGDSSNLPNPPATKPSIASNPLSPQTGPPAHSASLIPSVSNG
SLKFQSLTHTGKGHHLSFSPQSQNGRAPPPLSFSSSPPSPASSVSLNQGAKGTRTIHTPS
LTSYKAQNGSSSKATPSTAKETS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A2AQ25	0.159	0.159	0.000	1946	0.817	0.816	A2AQ25.pdb.gz	SKT_MOUSE Sickle tail protein OS=Mus musculus OX=10090 GN=Skt PE=1 SV=1
2	AFDB:Q5T5P2	0.999	0.999	0.000	1943	1.000	1.000	Q5T5P2.pdb.gz	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
3	AFDB:Q9QXY2	0.072	0.102	1.085E-47	1197	0.233	0.378	Q9QXY2.pdb.gz	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
4	AFDB:Q9VUQ9	0.035	0.033	1.270E-10	2139	0.142	0.129	Q9VUQ9.pdb.gz	Q9VUQ9_DROME non-specific serine/threonine protein kinase OS=Drosophila melanogaster OX=7227 GN=dop PE=1 SV=1
5	AFDB:Q9W1X4	0.037	0.040	1.132E-7	1711	0.110	0.125	Q9W1X4.pdb.gz	NU214_DROME Nuclear pore complex protein Nup214 OS=Drosophila melanogaster OX=7227 GN=Nup214 PE=1 SV=2
6	AFDB:P49750	0.054	0.050	6.868E-7	2146	0.133	0.120	P49750.pdb.gz	YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1 PE=1 SV=4
7	AFDB:P21263	0.037	0.038	9.850E-7	1893	0.127	0.130	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
8	AFDB:Q8TEK3	0.033	0.039	2.427E-6	1537	0.109	0.137	Q8TEK3.pdb.gz	DOT1L_HUMAN Histone-lysine N-methyltransferase, H3 lysine-79 specific OS=Homo sapiens OX=9606 GN=DOT1L PE=1 SV=3
9	AFDB:Q8R4U7	0.040	0.060	9.669E-6	1068	0.097	0.176	Q8R4U7.pdb.gz	LUZP1_MOUSE Leucine zipper protein 1 OS=Mus musculus OX=10090 GN=Luzp1 PE=1 SV=2
10	AFDB:Q13023	0.044	0.038	2.686E-5	2319	0.132	0.110	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
11	PDB:7lq1A	0.038	0.074	4.358E-2	950	0.006	0.013	7lq1A.pdb.gz	Discovery of a new series of PI3K-delta inhibitors from Virtual Screening.
12	PDB:1wz0A	0.037	0.432	4.915E-2	104	0.008	0.154	1wz0A.pdb.gz
13	PDB:5itdA	0.036	0.068	5.887E-2	995	0.007	0.014	5itdA.pdb.gz	Discovery and Pharmacological Characterization of Novel Quinazoline-Based PI3K Delta-Selective Inhibitors.
14	PDB:5dxhD	0.037	0.071	8.966E-2	981	0.006	0.012	5dxhD.pdb.gz	The Rational Design of Selective Benzoxazepin Inhibitors of the alpha-Isoform of Phosphoinositide 3-Kinase Culminating in the Identification of (S)-2-((2-(1-Isopropyl-1H-1,2,4-triazol-5-yl)-5,6-dihydrobenzo[f]imidazo[1,2-d][1,4]oxazepin-9-yl)oxy)propanamide (GDC-0326).
15	PDB:1a5rA	0.034	0.368	1.011E-1	103	0.007	0.136	1a5rA.pdb.gz
16	PDB:1m4vB	0.034	0.227	1.540E-1	197	0.007	0.071	1m4vB.pdb.gz
17	PDB:5swpA	0.037	0.065	2.346E-1	1060	0.008	0.014	5swpA.pdb.gz	Identification of allosteric binding sites for PI3K alpha oncogenic mutant specific inhibitor design.
18	PDB:2b5uA	0.033	0.111	2.645E-1	470	0.012	0.051	2b5uA.pdb.gz
19	PDB:7vvbB	0.033	0.515	2.809E-1	77	0.005	0.117	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
20	PDB:7bt6x	0.031	0.114	2.983E-1	488	0.005	0.018	7bt6x.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A2AQ25	0.0	2934	1946	0.818	0.817	SKT_MOUSE Sickle tail protein OS=Mus musculus OX=10090 GN=Skt PE=1 SV=1
2	Q5T5P2	0.0	3991	1943	1.000	1.000	SKT_HUMAN Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217 PE=1 SV=2
3	Q9C0H9	3.10e-158	521	1183	0.174	0.287	SRCN1_HUMAN SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4
4	Q9QXY2	8.25e-158	520	1197	0.177	0.287	SRCN1_RAT SRC kinase signaling inhibitor 1 OS=Rattus norvegicus OX=10116 GN=Srcin1 PE=1 SV=1
5	Q9QWI6	1.87e-150	501	1250	0.170	0.264	SRCN1_MOUSE SRC kinase signaling inhibitor 1 OS=Mus musculus OX=10090 GN=Srcin1 PE=1 SV=2
6	Q3V5J3	1.02e-07	59.7	832	0.032	0.076	Q3V5J3_CAEEL Actin interacting protein 3-like C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y71H2AM.15 PE=1 SV=1
7	H2L0S5	1.03e-07	59.7	836	0.032	0.075	H2L0S5_CAEEL Actin interacting protein 3-like C-terminal domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_Y71H2AM.15 PE=1 SV=1
8	Q94185	0.011	43.5	1254	0.013	0.020	Q94185_CAEEL DumPY: shorter than wild-type OS=Caenorhabditis elegans OX=6239 GN=dpy-6 PE=1 SV=2
9	Q99KW3	0.12	40.0	2014	0.036	0.035	TARA_MOUSE TRIO and F-actin-binding protein OS=Mus musculus OX=10090 GN=Triobp PE=1 SV=3
10	A1Z9M5	0.23	39.3	4012	0.016	0.008	A1Z9M5_DROME Titin OS=Drosophila melanogaster OX=7227 GN=Sdb PE=1 SV=1
11	Q63623	0.90	37.0	1268	0.023	0.035	SCAF8_RAT SR-related and CTD-associated factor 8 OS=Rattus norvegicus OX=10116 GN=Scaf8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03915 AIP3	1.6e-14	65.5	Actin interacting protein 3

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299518	0.810	Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial
2	9606.ENSP00000366460	0.701	Plexin domain-containing protein 2
3	9606.ENSP00000416040	0.678	Belongs to the UPF0606 family
4	9606.ENSP00000290846	0.661	Mitochondrial tRNA-specific 2-thiouridylase 1
5	9606.ENSP00000331897	0.647	Isocitrate dehydrogenase [NADP], mitochondrial
6	9606.ENSP00000387356	0.647	Aggrecan core protein
7	9606.ENSP00000316377	0.628	Disks large-associated protein 1
8	9606.ENSP00000421922	0.603	Alpha-2-macroglobulin receptor-associated protein
9	9606.ENSP00000319254	0.601	PDZ domain-containing protein GIPC3
10	9606.ENSP00000479910	0.597	Protein AF-17
11	9606.ENSP00000373347	0.587	SLIT-ROBO Rho GTPase-activating protein 3
12	9606.ENSP00000316775	0.585	Transmembrane protein 270
13	9606.ENSP00000379709	0.549	Rho GTPase-activating protein 21
14	9606.ENSP00000359045	0.536	Rho GTPase-activating protein 4
15	9606.ENSP00000329880	0.515	Phosphatase and actin regulator 1
16	9606.ENSP00000323927	0.510	Plexin domain-containing protein 1
17	9606.ENSP00000331544	0.505	Fibulin-1
18	9606.ENSP00000365757	0.502	Phosphatidylinositol 5-phosphate 4-kinase type-2 alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.947	multicellular organismal process
GO:0001501	0.924	skeletal system development
GO:0009792	0.901	embryo development ending in birth or egg hatching
GO:0043009	0.833	chordate embryonic development
GO:0009987	0.805	cellular process
GO:0065007	0.625	biological regulation
GO:0050789	0.557	regulation of biological process
GO:0050794	0.535	regulation of cellular process
GO:0048706	0.479	embryonic skeletal system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.998	intracellular organelle
GO:0005737	0.991	cytoplasm
GO:0043232	0.970	intracellular non-membrane-bounded organelle
GO:0043231	0.815	intracellular membrane-bounded organelle
GO:0005856	0.729	cytoskeleton
GO:0015630	0.555	microtubule cytoskeleton
GO:0005829	0.500	cytosol
GO:0005815	0.470	microtubule organizing center
GO:0070013	0.431	intracellular organelle lumen
GO:0005813	0.427	centrosome
GO:0031981	0.412	nuclear lumen
GO:0005654	0.377	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]