StarFunc result for job id Q5T5S1

User Input

>input (534 residues)
MRRHSETDVEEQTQELKTITQLQEQCRALQIQGVKENMDQNKATLALLRSNIRRGAQDWA
LAKKYDQWTISKACGKNLPLRLAHCRSTMEVVREKLRKYVFDRVNMHNLLIHLVRRRGQK
LESMQLELDSLRSQPDASKEELRLLQIIRQLENNIEKTMIKIITSQNIHLLYLDLLDYLK
TVLAGYPIELDKLQNLVVNYCSELSDMKIMSQDAMMITDEVKRNMRQREASFIEERRARE
NRLNQQKKLIDKIHTKETSEKYRRGQMDLDFPSNLMSTETLKLRRKETSTAEMEYQSGVT
AVVEKVKSAVRCSHVWDITSRFLAQRNTEENLELQMEDCEEWRVQLKALVKQLELEEAVL
KFRQKPSSISFKSVEKKMTDMLKEEEERLQLAHSNMTKGQELLLTIQMGIDNLYVRLMGI
NLPATQREVVLSNTLDLNSKLAYCEGKLTYLADRVQMVSRTEEGDTKVRDTLESSTLMEK
YNTRISFENREEDMIDTFQFPDMDHSYVPSRAEIKRQAQRLIEGKLKAAKKKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:G5E9W6	0.164	0.272	4.233E-22	318	0.419	0.704	G5E9W6.pdb.gz	G5E9W6_HUMAN Coiled-coil domain containing 183 OS=Homo sapiens OX=9606 GN=CCDC183 PE=1 SV=1
2	AFDB:A7MBH5	0.192	0.168	8.599E-14	621	0.234	0.201	A7MBH5.pdb.gz	ODAD3_BOVIN Outer dynein arm-docking complex subunit 3 OS=Bos taurus OX=9913 GN=ODAD3 PE=1 SV=1
3	AFDB:A0A2R8RI11	0.195	0.192	4.550E-13	545	0.210	0.206	A0A2R8RI11.pdb.gz
4	AFDB:Q8BSN3	0.195	0.178	2.724E-12	593	0.230	0.207	Q8BSN3.pdb.gz	ODAD3_MOUSE Outer dynein arm-docking complex subunit 3 OS=Mus musculus OX=10090 GN=ODAD3 PE=2 SV=2
5	AFDB:A5D8V7	0.188	0.171	4.952E-11	595	0.236	0.212	A5D8V7.pdb.gz	ODAD3_HUMAN Outer dynein arm-docking complex subunit 3 OS=Homo sapiens OX=9606 GN=ODAD3 PE=1 SV=1
6	AFDB:Q57ZQ9	0.226	0.201	2.918E-6	610	0.199	0.174	Q57ZQ9.pdb.gz	Q57ZQ9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.560 PE=4 SV=1
7	AFDB:Q9VTQ3	0.223	0.198	4.494E-6	614	0.174	0.151	Q9VTQ3.pdb.gz	Q9VTQ3_DROME Coiled-coil domain containing protein 151 OS=Drosophila melanogaster OX=7227 GN=CCDC151 PE=4 SV=1
8	AFDB:A8JF70	0.205	0.199	2.530E-5	552	0.148	0.143	A8JF70.pdb.gz	ODA1_CHLRE Outer dynein arm protein 1 OS=Chlamydomonas reinhardtii OX=3055 GN=ODA1 PE=1 SV=1
9	AFDB:Q57VZ5	0.171	0.139	1.938E-4	668	0.169	0.135	Q57VZ5.pdb.gz	Q57VZ5_TRYB2 Outer dynein arm docking complex OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.29H22.780 PE=4 SV=1
10	AFDB:Q96M63	0.249	0.207	2.151E-3	670	0.148	0.118	Q96M63.pdb.gz	ODAD1_HUMAN Outer dynein arm-docking complex subunit 1 OS=Homo sapiens OX=9606 GN=ODAD1 PE=1 SV=3
11	PDB:7sqkC	0.105	0.095	2.991	600	0.140	0.125	7sqkC.pdb.gz
12	PDB:2p22C	0.121	0.296	3.181	186	0.058	0.167	2p22C.pdb.gz
13	PDB:3aaiA	0.062	0.342	6.671	78	0.022	0.154	3aaiA.pdb.gz
14	PDB:3c98B	0.077	0.155	6.671	230	0.041	0.096	3c98B.pdb.gz
15	PDB:7payA	0.059	0.091	6.671	329	0.045	0.073	7payA.pdb.gz	Structural basis for long-chain isoprenoid synthesis by cis -prenyltransferases.
16	PDB:7r5sS	0.056	0.240	7.095	120	0.034	0.150	7r5sS.pdb.gz	Structure of the human inner kinetochore bound to a centromeric CENP-A nucleosome.
17	PDB:7msnA	0.056	0.066	7.547	417	0.049	0.062	7msnA.pdb.gz	Structural and mechanistic investigations of protein S-glycosyltransferases.
18	PDB:7ogtA	0.114	0.095	8.538	688	0.067	0.052	7ogtA.pdb.gz
19	PDB:6btlA	0.040	0.043	9.081	492	0.013	0.014	6btlA.pdb.gz	Biological Evaluation and X-ray Co-crystal Structures of Cyclohexylpyrrolidine Ligands for Trypanothione Reductase, an Enzyme from the Redox Metabolism of Trypanosoma.
20	PDB:7shfC	0.056	0.065	9.081	400	0.032	0.043	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G5E9W6	1.27e-158	456	318	0.416	0.698	G5E9W6_HUMAN Coiled-coil domain containing 183 OS=Homo sapiens OX=9606 GN=CCDC183 PE=1 SV=1
2	Q8BSN3	6.27e-16	83.2	593	0.251	0.226	ODAD3_MOUSE Outer dynein arm-docking complex subunit 3 OS=Mus musculus OX=10090 GN=ODAD3 PE=2 SV=2
3	F1QFD6	1.11e-14	79.0	545	0.230	0.226	F1QFD6_DANRE Coiled-coil domain containing 151 OS=Danio rerio OX=7955 GN=ccdc151 PE=1 SV=1
4	A5D8V7	1.70e-12	72.4	595	0.193	0.173	ODAD3_HUMAN Outer dynein arm-docking complex subunit 3 OS=Homo sapiens OX=9606 GN=ODAD3 PE=1 SV=1
5	A7MBH5	8.75e-10	63.5	621	0.225	0.193	ODAD3_BOVIN Outer dynein arm-docking complex subunit 3 OS=Bos taurus OX=9913 GN=ODAD3 PE=1 SV=1
6	Q57ZQ9	0.009	41.2	610	0.054	0.048	Q57ZQ9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.560 PE=4 SV=1
7	E7ETE2	1.1	34.3	512	0.043	0.045	E7ETE2_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
8	Q387J8	1.2	33.5	200	0.054	0.145	Q387J8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0550 PE=4 SV=1
9	A0A0B4KF84	2.6	33.5	8216	0.062	0.004	A0A0B4KF84_DROME Stretchin-Mlck, isoform S OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
10	A0A0B4KG35	2.6	33.5	8255	0.062	0.004	A0A0B4KG35_DROME Stretchin-Mlck, isoform U OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
11	A0A0B4JD82	2.7	33.5	7905	0.062	0.004	A0A0B4JD82_DROME Stretchin-Mlck, isoform T OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=1
12	A1ZA72	2.8	33.5	7944	0.062	0.004	A1ZA72_DROME Stretchin-Mlck, isoform V OS=Drosophila melanogaster OX=7227 GN=Strn-Mlck PE=1 SV=2
13	Q61768	3.2	33.1	963	0.051	0.028	KINH_MOUSE Kinesin-1 heavy chain OS=Mus musculus OX=10090 GN=Kif5b PE=1 SV=3
14	Q2PQA9	3.3	33.1	963	0.051	0.028	KINH_RAT Kinesin-1 heavy chain OS=Rattus norvegicus OX=10116 GN=Kif5b PE=1 SV=1
15	P33176	3.6	33.1	963	0.051	0.028	KINH_HUMAN Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1
16	V9HW29	3.6	33.1	963	0.051	0.028	V9HW29_HUMAN Kinesin-like protein OS=Homo sapiens OX=9606 GN=HEL-S-61 PE=1 SV=1
17	P12081	5.0	32.3	509	0.045	0.047	HARS1_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=2
18	B4DDD8	6.6	32.0	435	0.045	0.055	B4DDD8_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
19	B4E1C5	6.8	32.0	395	0.043	0.058	B4E1C5_HUMAN Histidine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=HARS1 PE=1 SV=1
20	Q9R269	7.1	32.0	1755	0.064	0.019	PEPL_MOUSE Periplakin OS=Mus musculus OX=10090 GN=Ppl PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338013

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360727	0.741	Rab-like protein 6
2	9606.ENSP00000387176	0.634	POTE ankyrin domain family member J
3	9606.ENSP00000392718	0.604	POTE ankyrin domain family member I
4	9606.ENSP00000221462	0.588	Protein phosphatase 1 regulatory subunit 37
5	9606.ENSP00000290079	0.587	Transmembrane protein 141
6	9606.ENSP00000299578	0.559	Uncharacterized protein C16orf46
7	9606.ENSP00000379451	0.519	Zinc finger protein 418
8	9606.ENSP00000392206	0.515	ArfGAP with GTPase domain, ankyrin repeat and PH domain 10
9	9606.ENSP00000392513	0.515	Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 4
10	9606.ENSP00000325895	0.503	Ankyrin repeat and death domain containing 1A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0000226	0.986	microtubule cytoskeleton organization
GO:0060271	0.986	cilium assembly
GO:0035082	0.983	axoneme assembly
GO:0032501	0.967	multicellular organismal process
GO:0032502	0.944	developmental process
GO:0007018	0.908	microtubule-based movement
GO:0003341	0.840	cilium movement
GO:0043933	0.710	protein-containing complex organization
GO:0048856	0.561	anatomical structure development
GO:0022412	0.337	cellular process involved in reproduction in multicellular organism

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	1.000	membrane-bounded organelle
GO:0005856	1.000	cytoskeleton
GO:0042995	0.995	cell projection
GO:0005929	0.990	cilium
GO:0015630	0.827	microtubule cytoskeleton
GO:0043231	0.730	intracellular membrane-bounded organelle
GO:0005737	0.565	cytoplasm
GO:0005815	0.530	microtubule organizing center

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]