StarFunc result for job id Q5T5U3

User Input

>input (1958 residues)
MMATRRTGLSEGDGDKLKACEVSKNKDGKEQSETVSLSEDETFSWPGPKTVTLKRTSQGF
GFTLRHFIVYPPESAIQFSYKDEENGNRGGKQRNRLEPMDTIFVKQVKEGGPAFEAGLCT
GDRIIKVNGESVIGKTYSQVIALIQNSDTTLELSVMPKDEDILQVLQFTKDVTALAYSQD
AYLKGNEAYSGNARNIPEPPPICYPWLPSAPSAMAQPVEISPPDSSLSKQQTSTPVLTQP
GRAYRMEIQVPPSPTDVAKSNTAVCVCNESVRTVIVPSEKVVDLLSNRNNHTGPSHRTEE
VRYGVSEQTSLKTVSRTTSPPLSIPTTHLIHQPAGSRSLEPSGILLKSGNYSGHSDGISS
SRSQAVEAPSVSVNHYSPNSHQHIDWKNYKTYKEYIDNRRLHIGCRTIQERLDSLRAASQ
STTDYNQVVPNRTTLQGRRRSTSHDRVPQSVQIRQRSVSQERLEDSVLMKYCPRSASQGA
LTSPSVSFSNHRTRSWDYIEGQDETLENVNSGTPIPDSNGEKKQTYKWSGFTEQDDRRGI
CERPRQQEIHKSFRGSNFTVAPSVVNSDNRRMSGRGVGSVSQFKKIPPDLKTLQSNRNFQ
TTCGMSLPRGISQDRSPLVKVRSNSLKAPSTHVTKPSFSQKSFVSIKDQRPVNHLHQNSL
LNQQTWVRTDSAPDQQVETGKSPSLSGASAKPAPQSSENAGTSDLELPVSQRNQDLSLQE
AETEQSDTLDNKEAVILREKPPSGRQTPQPLRHQSYILAVNDQETGSDTTCWLPNDARRE
VHIKRMEERKASSTSPPGDSLASIPFIDEPTSPSIDHDIAHIPASAVISASTSQVPSIAT
VPPCLTTSAPLIRRQLSHDHESVGPPSLDAQPNSKTERSKSYDEGLDDYREDAKLSFKHV
SSLKGIKIADSQKSSEDSGSRKDSSSEVFSDAAKEGWLHFRPLVTDKGKRVGGSIRPWKQ
MYVVLRGHSLYLYKDKREQTTPSEEEQPISVNACLIDISYSETKRKNVFRLTTSDCECLF
QAEDRDDMLAWIKTIQESSNLNEEDTGVTNRDLISRRIKEYNNLMSKAEQLPKTPRQSLS
IRQTLLGAKSEPKTQSPHSPKEESERKLLSKDDTSPPKDKGTWRKGIPSIMRKTFEKKPT
ATGTFGVRLDDCPPAHTNRYIPLIVDICCKLVEERGLEYTGIYRVPGNNAAISSMQEELN
KGMADIDIQDDKWRDLNVISSLLKSFFRKLPEPLFTNDKYADFIEANRKEDPLDRLKTLK
RLIHDLPEHHYETLKFLSAHLKTVAENSEKNKMEPRNLAIVFGPTLVRTSEDNMTHMVTH
MPDQYKIVETLIQHHDWFFTEEGAEEPLTTVQEESTVDSQPVPNIDHLLTNIGRTGVSPG
DVSDSATSDSTKSKGSWGSGKDQYSRELLVSSIFAAASRKRKKPKEKAQPSSSEDELDNV
FFKKENVEQCHNDTKEESKKESETLGRKQKIIIAKENSTRKDPSTTKDEKISLGKESTPS
EEPSPPHNSKHNKSPTLSCRFAILKESPRSLLAQKSSHLEETGSDSGTLLSTSSQASLAR
FSMKKSTSPETKHSEFLANVSTITSDYSTTSSATYLTSLDSSRLSPEVQSVAESKGDEAD
DERSELISEGRPVETDSESEFPVFPTALTSERLFRGKLQEVTKSSRRNSEGSELSCTEGS
LTSSLDSRRQLFSSHKLIECDTLSRKKSARFKSDSGSLGDAKNEKEAPSLTKVFDVMKKG
KSTGSLLTPTRGESEKQEPTWKTKIADRLKLRPRAPADDMFGVGNHKVNAETAKRKSIRR
RHTLGGHRDATEISVLNFWKVHEQSGERESELSAVNRLKPKCSAQDLSISDWLARERLRT
STSDLSRGEIGDPQTENPSTREIATTDTPLSLHCNTGSSSSTLASTNRPLLSIPPQSPDQ
INGESFQNVSKNASSAANAQPHKLSETPGSKAEFHPCL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T5U3	0.999	0.999	0.000	1958	1.000	1.000	Q5T5U3.pdb.gz	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
2	AFDB:Q6DFV3	0.283	0.285	0.000	1944	0.857	0.863	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
3	AFDB:X2JEI9	0.110	0.100	4.179E-47	2206	0.209	0.185	X2JEI9.pdb.gz	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
4	PDB:3cxlA	0.099	0.467	9.553E-16	402	0.038	0.184	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
5	AFDB:Q9V9S7	0.104	0.108	4.099E-15	1866	0.140	0.147	Q9V9S7.pdb.gz	SYDE_DROME Rho GTPase-activating protein 100F OS=Drosophila melanogaster OX=7227 GN=RhoGAP100F PE=1 SV=2
6	PDB:1xa6A	0.093	0.430	8.207E-14	399	0.038	0.185	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
7	PDB:6r3vA	0.098	0.909	2.000E-13	198	0.029	0.288	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
8	PDB:5c2kA	0.091	0.449	4.400E-12	382	0.032	0.165	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
9	AFDB:Q6P4F7	0.095	0.176	5.673E-11	1023	0.079	0.151	Q6P4F7.pdb.gz	RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens OX=9606 GN=ARHGAP11A PE=1 SV=2
10	PDB:5jcpA	0.091	0.479	9.681E-11	361	0.025	0.136	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
11	AFDB:P91621	0.054	0.051	1.801E-9	2072	0.135	0.128	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
12	AFDB:A8DZ29	0.052	0.053	5.150E-8	1919	0.124	0.126	A8DZ29.pdb.gz	A8DZ29_DROME Eukaryotic translation initiation factor 4G1, isoform B OS=Drosophila melanogaster OX=7227 GN=eIF4G1 PE=1 SV=1
13	AFDB:X2JEM2	0.037	0.034	9.656E-8	2326	0.138	0.116	X2JEM2.pdb.gz	X2JEM2_DROME Secretory 16, isoform I OS=Drosophila melanogaster OX=7227 GN=Sec16 PE=1 SV=1
14	AFDB:Q9VIS1	0.098	0.104	2.119E-7	1843	0.112	0.119	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
15	AFDB:Q9VDE9	0.094	0.137	2.233E-7	1330	0.093	0.138	Q9VDE9.pdb.gz	Q9VDE9_DROME FI04035p OS=Drosophila melanogaster OX=7227 GN=RhoGAP93B PE=2 SV=2
16	PDB:6hhgA	0.045	0.211	1.840E-5	386	0.015	0.075	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
17	PDB:6bbpA	0.051	0.177	6.139E-5	520	0.014	0.052	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
18	PDB:7pcbA	0.046	0.193	8.859E-5	415	0.020	0.096	7pcbA.pdb.gz	A scalable strategy to solve structures of PDZ domains and their complexes.
19	PDB:3ljuX	0.047	0.227	1.213E-4	373	0.009	0.046	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
20	PDB:6s9wA	0.046	0.204	1.213E-4	411	0.014	0.066	6s9wA.pdb.gz	Covalent-Allosteric Inhibitors to Achieve Akt Isoform-Selectivity.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A087WW76	0.0	1201	1406	0.296	0.412	A0A087WW76_HUMAN Rho GTPase activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
2	J3JSM9	0.0	1206	1406	0.297	0.413	J3JSM9_HUMAN ARHGAP21 protein OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1
3	Q5T5U3	0.0	4029	1958	1.000	1.000	RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=2
4	Q6DFV3	0.0	3353	1945	0.860	0.866	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
5	Q9P227	0.0	600	1491	0.183	0.240	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
6	P34288	5.60e-59	228	1605	0.054	0.065	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
7	Q9VRA6	6.22e-49	195	2181	0.047	0.043	Q9VRA6_DROME Rho GTPase activating protein at 19D, isoform A OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=2
8	X2JEI9	6.32e-49	195	2206	0.047	0.042	X2JEI9_DROME Rho GTPase activating protein at 19D, isoform D OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
9	Q95TR0	6.55e-49	195	1553	0.047	0.060	Q95TR0_DROME LD29482p OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=2 SV=1
10	M9NFH4	6.61e-49	195	2135	0.047	0.044	M9NFH4_DROME Rho GTPase activating protein at 19D, isoform C OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
11	E1JJS2	7.89e-49	195	2109	0.047	0.044	E1JJS2_DROME Rho GTPase activating protein at 19D, isoform B OS=Drosophila melanogaster OX=7227 GN=RhoGAP19D PE=1 SV=1
12	Q53QZ3	2.82e-44	171	475	0.074	0.303	RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens OX=9606 GN=ARHGAP15 PE=1 SV=2
13	Q1RLN5	7.98e-38	156	799	0.066	0.163	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
14	Q8IWW6	1.10e-37	156	846	0.066	0.154	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
15	Q03070	8.86e-36	140	295	0.038	0.251	CHIO_RAT Beta-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn2 PE=2 SV=1
16	P30337	9.21e-34	136	334	0.036	0.210	CHIN_RAT N-chimaerin OS=Rattus norvegicus OX=10116 GN=Chn1 PE=1 SV=2
17	Q7ZUT6	1.87e-33	138	459	0.036	0.153	Q7ZUT6_DANRE Chimerin (Chimaerin) 1 OS=Danio rerio OX=7955 GN=chimaerin PE=1 SV=1
18	Q6TLK4	4.14e-33	142	869	0.066	0.150	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
19	P15882	7.06e-33	136	459	0.037	0.159	CHIN_HUMAN N-chimaerin OS=Homo sapiens OX=9606 GN=CHN1 PE=1 SV=3
20	P52757	1.34e-32	136	468	0.037	0.156	CHIO_HUMAN Beta-chimaerin OS=Homo sapiens OX=9606 GN=CHN2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00595 PDZ	1.5e-06	39.8	PDZ domain
2	PF13180 PDZ_2	0.047	25.4	PDZ domain
3	PF17820 PDZ_6	1.3e-09	49.1	PDZ domain
4	PF02163 Peptidase_M50	0.79	20.5	Peptidase family M50
5	PF00169 PH	6.2e-10	50.9	PH domain
6	PF15413 PH_11	35	16.3	Pleckstrin homology domain
7	PF16652 PH_13	1.1e+02	14.1	Pleckstrin homology domain
8	PF15410 PH_9	1.8e-07	42.8	Pleckstrin homology domain
9	PF00620 RhoGAP	3.4e-45	165.0	RhoGAP domain
10	PF14685 Tricorn_PDZ	3.6e+02	12.6	Tricorn protease PDZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379709

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000328551	0.941	Ras-related protein Rab-28
2	9606.ENSP00000440005	0.927	ADP-ribosylation factor 1
3	9606.ENSP00000409581	0.837	Beta-arrestin-1
4	9606.ENSP00000369592	0.795	Coiled-coil domain-containing protein 85C
5	9606.ENSP00000384040	0.765	Coiled-coil domain containing 85A
6	9606.ENSP00000311695	0.743	Coiled-coil domain-containing protein 85B
7	9606.ENSP00000364526	0.742	Junctional protein associated with coronary artery disease
8	9606.ENSP00000337261	0.697	Rho guanine nucleotide exchange factor 1
9	9606.ENSP00000401831	0.666	Acyl-CoA synthetase family member 2, mitochondrial
10	9606.ENSP00000354504	0.639	Astrotactin-2
11	9606.ENSP00000283629	0.638	Upstream-binding protein 1
12	9606.ENSP00000262215	0.633	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
13	9606.ENSP00000354837	0.569	Rho guanine nucleotide exchange factor 2
14	9606.ENSP00000338785	0.566	StAR-related lipid transfer protein 13
15	9606.ENSP00000383118	0.554	Cell division control protein 42 homolog
16	9606.ENSP00000307134	0.553	Catenin delta-2
17	9606.ENSP00000365637	0.549	Sickle tail protein homolog
18	9606.ENSP00000345064	0.548	Prickle-like protein 1
19	9606.ENSP00000400175	0.540	Transforming protein RhoA
20	9606.ENSP00000304669	0.537	Catenin alpha-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.988	regulation of cellular process
GO:0009987	0.979	cellular process
GO:0023051	0.938	regulation of signaling
GO:0010646	0.938	regulation of cell communication
GO:0048583	0.918	regulation of response to stimulus
GO:0009966	0.914	regulation of signal transduction
GO:0051056	0.896	regulation of small GTPase mediated signal transduction
GO:0016043	0.820	cellular component organization
GO:0051179	0.801	localization
GO:0051234	0.557	establishment of localization
GO:0006810	0.550	transport
GO:0050896	0.449	response to stimulus
GO:0006996	0.449	organelle organization
GO:0051716	0.412	cellular response to stimulus
GO:0007154	0.363	cell communication

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005622	1.000	intracellular anatomical structure
GO:0005886	1.000	plasma membrane
GO:0012505	0.997	endomembrane system
GO:0005829	0.994	cytosol
GO:0043231	0.994	intracellular membrane-bounded organelle
GO:0043232	0.991	intracellular non-membrane-bounded organelle
GO:0030054	0.914	cell junction
GO:0005856	0.830	cytoskeleton
GO:0015629	0.748	actin cytoskeleton
GO:0005794	0.686	Golgi apparatus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]