StarFunc result for job id Q5T5X7

User Input

>input (828 residues)
MNSTEFTEDVEEVLKSITVKVETEAEDAALDCSVNSRTSEKHSVDSVLTALQDSSKRKQL
VSDGLLDSVPGVKRRRLIPEALLAGMRNRENSSPCQGNGEQAGRGRSLGNVWPGEEEPCN
DATTPSYKKPLYGISHKIMEKKNPPSGDLLNVYELFEKANASNSPSSLRLLNEPQKRDCG
STGAGTDNDPNIYFLIQKMFYMLNTLTSNMSQLHSKVDLLSLEVSRIKKQVSPTEMVAKF
QPPPEYQLTAAELKQIVDQSLSGGDLACRLLVQLFPELFSDVDFSRGCSACGFAAKRKLE
SLHLQLIRNYVEVYYPSVKDTAVWQAECLPQLNDFFSRFWAQREMEDSQPSGQVASFFEA
EQVDPGHFLDNKDQEEALSLDRSSTIASDHVVDTQDLTEFLDEASSPGEFAVFLLHRLFP
ELFDHRKLGEQYSCYGDGGKQELDPQRLQIIRNYTEIYFPDMQEEEAWLQQCAQRINDEL
EGLGLDAGSEGDPPRDDCYDSSSLPDDISVVKVEDSFEGERPGRRSKKIWLVPIDFDKLE
IPQPDFEVPGADCLLSKEQLRSIYESSLSIGNFASRLLVHLFPELFTHENLRKQYNCSGS
LGKKQLDPSRIKLIRHYVQLLYPRAKNDRVWTLEFVGKLDERCRRRDTEQRRSYQQQRKV
HVPGPECRDLTSYAINPERFREEFEGPPLPPERSSKDFCKIPLDELVVPSPDFPVPSPYL
LSDKEVREIVQQSLSVGNFAARLLVRLFPELFTAENLRLQYNHSGACNKKQLDPTRLRLI
RHYVEAVYPVEKMEEVWHYECIPSIDERCRRPNRKKCDILKKAKKVEK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T5X7	1.000	1.000	1.599E-103	828	1.000	1.000	Q5T5X7.pdb.gz	BEND3_HUMAN BEN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=BEND3 PE=1 SV=1
2	AFDB:Q8NDZ0	0.109	0.112	1.935E-5	799	0.146	0.151	Q8NDZ0.pdb.gz	BEND2_HUMAN BEN domain-containing protein 2 OS=Homo sapiens OX=9606 GN=BEND2 PE=1 SV=2
3	AFDB:Q9USU1	0.075	0.066	8.427E-3	987	0.152	0.128	Q9USU1.pdb.gz	EFC25_SCHPO Ras guanine nucleotide exchange factor efc25 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=efc25 PE=1 SV=1
4	AFDB:A0A0B4LFI1	0.043	0.035	4.320E-2	1089	0.103	0.078	A0A0B4LFI1.pdb.gz	A0A0B4LFI1_DROME Stac-like, isoform U OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
5	AFDB:Q5AMQ6	0.066	0.056	9.185E-2	1111	0.123	0.092	Q5AMQ6.pdb.gz	RFX2_CANAL RFX-like DNA-binding protein RFX2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RFX2 PE=2 SV=2
6	AFDB:Q960T2	0.074	0.099	2.037E-1	551	0.095	0.143	Q960T2.pdb.gz	SAP47_DROME Synapse-associated protein of 47 kDa OS=Drosophila melanogaster OX=7227 GN=Sap47 PE=1 SV=1
7	AFDB:A0A0B4KG20	0.040	0.042	2.309E-1	1166	0.110	0.078	A0A0B4KG20.pdb.gz	A0A0B4KG20_DROME Stac-like, isoform H OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
8	AFDB:Q3TVI8	0.065	0.070	2.309E-1	727	0.117	0.133	Q3TVI8.pdb.gz	PBIP1_MOUSE Pre-B-cell leukemia transcription factor-interacting protein 1 OS=Mus musculus OX=10090 GN=Pbxip1 PE=1 SV=2
9	AFDB:A0A0B4LF79	0.043	0.038	2.731E-1	1000	0.093	0.077	A0A0B4LF79.pdb.gz	A0A0B4LF79_DROME Stac-like, isoform Q OS=Drosophila melanogaster OX=7227 GN=Stacl PE=4 SV=1
10	AFDB:F4I700	0.051	0.057	2.848E-1	717	0.089	0.103	F4I700.pdb.gz	UBN2_ARATH Ubinuclein-2 OS=Arabidopsis thaliana OX=3702 GN=UBN2 PE=1 SV=1
11	PDB:6nr7A	0.065	0.053	6.795E-1	1086	0.074	0.056	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
12	PDB:7qp6y	0.056	0.064	1.385	697	0.052	0.062	7qp6y.pdb.gz	Conformational rearrangements upon start codon recognition in human 48S translation initiation complex.
13	PDB:3javA	0.067	0.033	2.389	2327	0.100	0.036	3javA.pdb.gz
14	PDB:6nmiC	0.057	0.094	3.950	408	0.031	0.064	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
15	PDB:5jxdA	0.053	0.147	4.119	186	0.024	0.108	5jxdA.pdb.gz	The Tnfaip8-PE complex is a novel upstream effector in the anti-autophagic action of insulin
16	PDB:1huwA	0.050	0.143	4.295	166	0.030	0.151	1huwA.pdb.gz
17	PDB:4v98AN	0.047	0.120	4.295	216	0.039	0.148	4v98AN.pdb.gz	Structural Basis of Assembly Chaperone- Mediated snRNP Formation.
18	PDB:6jcxF	0.060	0.182	4.479	186	0.036	0.161	6jcxF.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
19	PDB:3rm5A	0.050	0.070	4.671	521	0.025	0.040	3rm5A.pdb.gz
20	PDB:7kzqE	0.059	0.091	4.671	419	0.062	0.122	7kzqE.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T5X7	0.0	1703	828	1.000	1.000	BEND3_HUMAN BEN domain-containing protein 3 OS=Homo sapiens OX=9606 GN=BEND3 PE=1 SV=1
2	Q5YLB2	3.2	33.9	1399	0.018	0.011	Q5YLB2_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=1
3	Q9GKK8	3.5	33.9	1863	0.018	0.008	BRCA1_PANTR Breast cancer type 1 susceptibility protein homolog OS=Pan troglodytes OX=9598 GN=BRCA1 PE=2 SV=2
4	P38398	3.7	33.9	1863	0.018	0.008	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
5	Q9QXZ0	5.2	33.5	7354	0.064	0.007	MACF1_MOUSE Microtubule-actin cross-linking factor 1, isoforms 1/2/3/4 OS=Mus musculus OX=10090 GN=Macf1 PE=1 SV=2
6	A0A0G2KYH9	6.5	30.4	98	0.017	0.143	A0A0G2KYH9_DANRE Chemokine (C-X-C motif) ligand 8a OS=Danio rerio OX=7955 GN=cxcl8a PE=3 SV=1
7	Q61122	8.9	32.3	486	0.025	0.043	NAB1_MOUSE NGFI-A-binding protein 1 OS=Mus musculus OX=10090 GN=Nab1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10523 BEN	2.5e-76	263.3	BEN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000411268

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000334675	0.901	DNA excision repair protein ERCC-6-like
2	9606.ENSP00000384867	0.780	Uncharacterized protein C6orf203
3	9606.ENSP00000305151	0.718	PWWP domain-containing protein 2A
4	9606.ENSP00000230588	0.690	Meprin A subunit alpha
5	9606.ENSP00000356981	0.655	Ubiquitin carboxyl-terminal hydrolase 21
6	9606.ENSP00000358059	0.558	Reticulon-4-interacting protein 1, mitochondrial
7	9606.ENSP00000357998	0.555	Translocation protein SEC63 homolog
8	9606.ENSP00000376902	0.508	Protein BANP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0000182	1.000	rDNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.996	biological regulation
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.980	primary metabolic process
GO:0006807	0.976	nitrogen compound metabolic process
GO:0044237	0.971	cellular metabolic process
GO:0019538	0.968	protein metabolic process
GO:0016043	0.961	cellular component organization
GO:0048523	0.928	negative regulation of cellular process
GO:0006338	0.928	chromatin remodeling
GO:0019222	0.923	regulation of metabolic process
GO:0044260	0.923	cellular macromolecule metabolic process
GO:0060255	0.899	regulation of macromolecule metabolic process
GO:0036211	0.896	protein modification process
GO:0016570	0.892	histone modification
GO:0031323	0.886	regulation of cellular metabolic process
GO:0048522	0.884	positive regulation of cellular process
GO:0031326	0.878	regulation of cellular biosynthetic process
GO:0051171	0.872	regulation of nitrogen compound metabolic process
GO:0080090	0.871	regulation of primary metabolic process
GO:0010468	0.870	regulation of gene expression
GO:0019219	0.864	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.847	regulation of RNA metabolic process
GO:0006355	0.844	regulation of DNA-templated transcription
GO:0031324	0.836	negative regulation of cellular metabolic process
GO:1901360	0.826	organic cyclic compound metabolic process
GO:0046483	0.819	heterocycle metabolic process
GO:0031325	0.815	positive regulation of cellular metabolic process
GO:0010605	0.805	negative regulation of macromolecule metabolic process
GO:0045934	0.805	negative regulation of nucleobase-containing compound metabolic process
GO:0043414	0.802	macromolecule methylation
GO:0018205	0.802	peptidyl-lysine modification
GO:0034641	0.801	cellular nitrogen compound metabolic process
GO:0006725	0.796	cellular aromatic compound metabolic process
GO:0006479	0.792	protein methylation
GO:0045935	0.778	positive regulation of nucleobase-containing compound metabolic process
GO:0009890	0.754	negative regulation of biosynthetic process
GO:0051253	0.637	negative regulation of RNA metabolic process
GO:0031327	0.631	negative regulation of cellular biosynthetic process
GO:0006473	0.621	protein acetylation
GO:0016571	0.621	histone methylation
GO:0018022	0.621	peptidyl-lysine methylation
GO:0090304	0.585	nucleic acid metabolic process
GO:0018393	0.568	internal peptidyl-lysine acetylation
GO:0007000	0.559	nucleolus organization
GO:0016573	0.534	histone acetylation
GO:0010558	0.509	negative regulation of macromolecule biosynthetic process
GO:0006140	0.424	regulation of nucleotide metabolic process
GO:1903578	0.403	regulation of ATP metabolic process
GO:0006259	0.361	DNA metabolic process
GO:0006357	0.304	regulation of transcription by RNA polymerase II
GO:1902679	0.304	negative regulation of RNA biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0000792	0.998	heterochromatin
GO:0005730	0.998	nucleolus
GO:0005737	0.517	cytoplasm
GO:0016020	0.470	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]