StarFunc result for job id Q5T5Y3

User Input

>input (1602 residues)
MVDASGRAAAEGWRKMEAPPDGAADLVPLDRYDAARAKIAANLQWICAKAYGRDNIPEDL
RDPFYVDQYEQEHIKPPVIKLLLSSELYCRVCSLILKGDQVAALQGHQSVIQALSRKGIY
VMESDDTPVTESDLSRAPIKMSAHMAMVDALMMAYTVEMISIEKVVASVKRFSTFSASKE
LPYDLEDAMVFWINKVNLKMREITEKEVKLKQQLLESPAHQKVRYRREHLSARQSPYFPL
LEDLMRDGSDGAALLAVIHYYCPEQMKLDDICLKEVTSMADSLYNIRLLREFSNEYLNKC
FYLTLEDMLYAPLVLKPNVMVFIAELFWWFENVKPDFVQPRDVQELKDAKTVLHQKSSRP
PVPISNATKRSFLGSPAAGTLAELQPPVQLPAEGCHRHYLHPEEPEYLGKGTAAFSPSHP
LLPLRQKQQKSIQGEDIPDQRHRSNSLTRVDGQPRGAAIAWPEKKTRPASQPTPFALHHA
ASCEVDPSSGDSISLARSISKDSLASNIVNLTPQNQPHPTATKSHGKSLLSNVSIEDEEE
ELVAIVRADVVPQQADPEFPRASPRALGLTANARSPQGQLDTSESKPDSFFLEPLMPAVL
KPAKEKQVITKEDERGEGRPRSIVSRRPSEGPQPLVRRKMTGSRDLNRTFTPIPCSEFPM
GIDPTETGPLSVETAGEVCGGPLALGGFDPFPQGPSTDGFFLHVGRADEDTEGRLYVSCS
KSPNSHDSEPWTLLRQDSDSDVVDIEEAEHDFMGEAHPVVFSRYIGEEESAKLQEDMKVK
EHEDKDDASGRSSPCLSTASQMSSVSMASGSVKMTSFAERKLQRLNSCETKSSTSSSQKT
TPDASESCPAPLTTWRQKREQSPSQHGKDPASLLASELVQLHMQLEEKRRAIEAQKKKME
ALSARQRLKLGKAAFLHVVKKGKAEAAPPLRPEHFAKEYSQHNGEDCGDAVSKTEDFLVK
EEQREELLHEPQDVDKESLAFAQQHKAKDPVALHELERNKVISAALLEDTVGEVVDVNEC
DLSIEKLNETISTLQQAILKISQQQEQLLMKSPTVPVPGSKNNSQDHKVKAPVHFVEPLS
PTGVAGHRKAPRLGQGRNSRSGRPAELKVPKDRPQGSSRSKTPTPSVETLPHLRPFPASS
HPRTPTDPGLDSALEPSGDPHGKCLFDSYRLHDESNQRTLTLSSSKDANILSEQMSLKEV
LDASVKEVGSSSSDVSGKESVPVEEPLRSRASLIEVDLSDLKAPDEDGELVSLDGSADLV
SEGDQKPGVGFFFKDEQKAEDELAKKRAAFLLKQQRKAEEARVRKQQLEAEVELKRDEAR
RKAEEDRVRKEEEKARRELIKQEYLRRKQQQILEEQGLGKPKSKPKKPRPKSVHREESCS
DSGTKCSSTPDNLSRTQSGSSLSLASAATTEPESVHSGGTPSQRVESMEALPILSRNPSR
STDRDWETASAASSLASVAEYTGPKLFKEPSSKSNKPIIHNAISHCCLAGKVNEPHKNSI
LEELEKCDANHYIILFRDAGCQFRALYCYYPDTEEIYKLTGTGPKNITKKMIDKLYKYSS
DRKQFNLIPAKTMSVSVDALTIHNHLWQPKRPAVPKKAQTRK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T5Y3	1.000	1.000	0.000	1602	1.000	1.000	Q5T5Y3.pdb.gz	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
2	AFDB:A0A024R899	0.061	0.076	1.408E-4	1191	0.107	0.144	A0A024R899.pdb.gz
3	AFDB:O96433	0.052	0.063	6.612E-4	1097	0.107	0.156	O96433.pdb.gz	CCNT_DROME Cyclin-T OS=Drosophila melanogaster OX=7227 GN=CycT PE=1 SV=2
4	AFDB:Q380Z7	0.053	0.046	1.323E-3	2059	0.132	0.103	Q380Z7.pdb.gz	Q380Z7_TRYB2 Flagellar Member 7 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8650 PE=4 SV=1
5	AFDB:E1JJ76	0.035	0.044	2.509E-3	1165	0.091	0.124	E1JJ76.pdb.gz	E1JJ76_DROME Alhambra, isoform H OS=Drosophila melanogaster OX=7227 GN=Alh PE=4 SV=1
6	AFDB:Q9H2Y7	0.059	0.052	3.276E-3	1883	0.120	0.102	Q9H2Y7.pdb.gz	ZN106_HUMAN Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1
7	AFDB:P78312	0.056	0.065	3.844E-3	1265	0.102	0.129	P78312.pdb.gz	F193A_HUMAN Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A PE=1 SV=2
8	AFDB:O88466	0.043	0.039	4.759E-3	1888	0.127	0.108	O88466.pdb.gz	ZN106_MOUSE Zinc finger protein 106 OS=Mus musculus OX=10090 GN=Znf106 PE=1 SV=3
9	AFDB:H2KYH3	0.037	0.024	5.295E-3	2476	0.124	0.080	H2KYH3.pdb.gz	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
10	AFDB:Q9VFH4	0.034	0.045	5.891E-3	1200	0.095	0.127	Q9VFH4.pdb.gz	Q9VFH4_DROME LD12755p OS=Drosophila melanogaster OX=7227 GN=l(3)L1231 PE=2 SV=1
11	PDB:4d1eA	0.101	0.176	5.375E-2	859	0.027	0.051	4d1eA.pdb.gz
12	PDB:7sx8D	0.109	0.334	6.654E-2	448	0.022	0.078	7sx8D.pdb.gz	Structural mechanism for bidirectional actin cross-linking by T-plastin.
13	PDB:3euhB	0.035	0.125	2.394E-1	321	0.022	0.109	3euhB.pdb.gz
14	PDB:6k5vA	0.050	0.130	2.663E-1	433	0.022	0.083	6k5vA.pdb.gz
15	PDB:6zu0C	0.046	0.097	2.963E-1	426	0.027	0.103	6zu0C.pdb.gz
16	PDB:7jq9A	0.038	0.028	4.081E-1	2427	0.020	0.013	7jq9A.pdb.gz
17	PDB:3o8jA	0.051	0.130	6.596E-1	364	0.030	0.132	3o8jA.pdb.gz
18	PDB:7r5jB0	0.045	0.043	9.582E-1	1748	0.031	0.028	7r5jB0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
19	PDB:7k36I	0.036	0.072	1.011	599	0.028	0.075	7k36I.pdb.gz	Cryo-EM structure of the Hippo signaling integrator human STRIPAK.
20	PDB:2r8uB	0.053	0.494	1.124	136	0.009	0.110	2r8uB.pdb.gz	Structure of fragment of human end-binding protein 1 (EB1) containing the N-terminal domain at 1.35 A resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3Z8E6	0.0	2667	1604	0.861	0.860	CAMP1_RAT Calmodulin-regulated spectrin-associated protein 1 OS=Rattus norvegicus OX=10116 GN=Camsap1 PE=1 SV=2
2	Q5T5Y3	0.0	3294	1602	1.000	1.000	CAMP1_HUMAN Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1 PE=1 SV=2
3	Q8C1B1	4.24e-152	505	1461	0.236	0.259	CAMP2_MOUSE Calmodulin-regulated spectrin-associated protein 2 OS=Mus musculus OX=10090 GN=Camsap2 PE=1 SV=3
4	D4AEC2	1.07e-151	504	1470	0.235	0.256	CAMP2_RAT Calmodulin-regulated spectrin-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Camsap2 PE=1 SV=1
5	Q08AD1	6.26e-149	497	1489	0.235	0.253	CAMP2_HUMAN Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2 PE=1 SV=3
6	Q80VC9	8.43e-87	313	1252	0.120	0.154	CAMP3_MOUSE Calmodulin-regulated spectrin-associated protein 3 OS=Mus musculus OX=10090 GN=Camsap3 PE=1 SV=1
7	Q9P1Y5	8.97e-80	291	1249	0.122	0.157	CAMP3_HUMAN Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2
8	U4PAZ9	1.86e-40	166	1112	0.062	0.090	PTRN1_CAEEL Patronin (microtubule-binding protein) homolog OS=Caenorhabditis elegans OX=6239 GN=ptrn-1 PE=1 SV=1
9	A1ZAU8	1.06e-38	161	1630	0.042	0.042	PTRO_DROME Patronin OS=Drosophila melanogaster OX=7227 GN=Patronin PE=1 SV=1
10	Q8IDX6	0.062	40.8	3130	0.019	0.010	RH2A_PLAF7 Reticulocyte-binding protein homolog 2a OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=RH2a PE=1 SV=1
11	Q75JH9	0.55	37.4	1503	0.012	0.013	Q75JH9_DICDI Actin binding protein OS=Dictyostelium discoideum OX=44689 GN=enlA PE=4 SV=1
12	B2ZX90	0.85	37.0	940	0.014	0.024	FAS1_ORYSJ Chromatin assembly factor 1 subunit FSM OS=Oryza sativa subsp. japonica OX=39947 GN=FSM PE=2 SV=1
13	Q6GLZ5	4.1	34.3	425	0.017	0.064	SEPT7_XENLA Septin-7 OS=Xenopus laevis OX=8355 GN=septin7 PE=2 SV=1
14	Q9UIF8	4.6	34.7	2168	0.014	0.011	BAZ2B_HUMAN Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B PE=1 SV=3
15	A2AUY4	6.2	33.9	2123	0.014	0.011	BAZ2B_MOUSE Bromodomain adjacent to zinc finger domain protein 2B OS=Mus musculus OX=10090 GN=Baz2b PE=1 SV=1
16	A8JNJ6	7.7	33.9	4337	0.036	0.013	A8JNJ6_DROME Karst, isoform E OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=2
17	M9PBL6	8.4	33.5	4321	0.036	0.013	M9PBL6_DROME Karst, isoform G OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
18	Q7KV70	9.8	33.5	4207	0.036	0.014	Q7KV70_DROME Karst, isoform C OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1
19	Q7KV69	9.9	33.5	4118	0.036	0.014	Q7KV69_DROME Karst, isoform B OS=Drosophila melanogaster OX=7227 GN=kst PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF17095 CAMSAP_CC1	1.2e-20	84.5	Spectrin-binding region of Ca2+-Calmodulin
2	PF11971 CAMSAP_CH	4.7e-31	117.7	CAMSAP CH domain
3	PF08683 CAMSAP_CKK	1.7e-52	187.9	Microtubule-binding calmodulin-regulated spectrin-associated

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000374183

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000259818	0.823	Tubulin beta-2B chain
2	9606.ENSP00000336799	0.817	Tubulin alpha-1B chain
3	9606.ENSP00000301071	0.816	Tubulin alpha-1A chain
4	9606.ENSP00000339001	0.815	Tubulin beta chain
5	9606.ENSP00000360821	0.799	Ubiquitin-associated domain-containing protein 1
6	9606.ENSP00000362551	0.748	Zinc finger and BTB domain-containing protein 34
7	9606.ENSP00000356115	0.736	Major facilitator superfamily domain containing 4
8	9606.ENSP00000298545	0.716	Adenylate kinase 8
9	9606.ENSP00000360757	0.716	Protein FAM69B
10	9606.ENSP00000482438	0.707	Mediator of RNA polymerase II transcription subunit 22
11	9606.ENSP00000361092	0.690	Surfeit locus protein 6
12	9606.ENSP00000298532	0.676	snRNA-activating protein complex subunit 4
13	9606.ENSP00000341490	0.673	Isthmin-2
14	9606.ENSP00000307959	0.667	Dystonin
15	9606.ENSP00000361151	0.667	Bile salt-activated lipase
16	9606.ENSP00000361057	0.637	Surfeit locus protein 4
17	9606.ENSP00000354573	0.632	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
18	9606.ENSP00000253669	0.565	HAUS augmin-like complex subunit 8
19	9606.ENSP00000360323	0.562	Tetratricopeptide repeat domain containing
20	9606.ENSP00000277541	0.545	Neurogenic locus notch homolog protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0030507	1.000	spectrin binding
GO:0051011	1.000	microtubule minus-end binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0007399	0.988	nervous system development
GO:0050794	0.976	regulation of cellular process
GO:0071840	0.974	cellular component organization or biogenesis
GO:0016043	0.963	cellular component organization
GO:0030154	0.923	cell differentiation
GO:0051128	0.908	regulation of cellular component organization
GO:0048699	0.850	generation of neurons
GO:0030030	0.833	cell projection organization
GO:0006996	0.782	organelle organization
GO:0031175	0.762	neuron projection development
GO:0007017	0.751	microtubule-based process
GO:0007010	0.449	cytoskeleton organization
GO:0032886	0.420	regulation of microtubule-based process
GO:0033043	0.379	regulation of organelle organization
GO:1902903	0.374	regulation of supramolecular fiber organization
GO:0070507	0.355	regulation of microtubule cytoskeleton organization
GO:0000226	0.342	microtubule cytoskeleton organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:1990752	0.999	microtubule end
GO:0005737	0.935	cytoplasm
GO:0043227	0.806	membrane-bounded organelle
GO:0036449	0.780	microtubule minus-end
GO:0043231	0.741	intracellular membrane-bounded organelle
GO:0005634	0.662	nucleus
GO:0005829	0.658	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]