StarFunc result for job id Q5T619

User Input

>input (568 residues)
MAQVDSQDRWGEASPLSSLTEEAHDTQMLSMNLESDDEDGGEAEKEGTADPVACPRGSSP
VTHENPDLPWPHPLGKEEEKFSDSSSAGGMGQKPVEMSGKASWSRDVTKINETQGSPGAS
RALGSLPSGLAHKLLGQMQPLGDRLPAGDDGYSGANQDAVLDVPPSFPSNGKYLCAHKSV
DTSAGNSSLLCFPRPGSNWDLPTQETHTPAQASATPASLAAAVLAKARNSRKVQNQAGRR
EGGEAEARPYRCLRGGRAFQKPSKPLSPAETRGGAAKRYACELCGKAYSHRGTLQQHRRL
HTGERPYQCSFCDKAYTWSSDHRKHIRTHTGEKPYPCPDCGKAFVRSSDLRKHQRNMHSN
NKPFPCSECGLTFNKPLSLLRHQRTHLGAKPFRCPACDREFAVASRMVEHQRVHSGERPF
PCPTCGKCFTKSSNLSEHQTLHTGQRPFKCADCGVAFAQPSRLVRHQRIHTGERPFPCTQ
CGQAFARSSTLKRHQQIHSGEKGFLCAECGRAFRIASELAQHIRMHNGERPYQCEDCGQA
FTRSNHLQRHRAKHGTCKKEPIPSSSDE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T619	1.000	1.000	1.242E-93	568	1.000	1.000	Q5T619.pdb.gz	ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens OX=9606 GN=ZNF648 PE=1 SV=1
2	AFDB:Q15937	0.322	0.364	2.011E-37	498	0.320	0.365	Q15937.pdb.gz	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
3	AFDB:Q68DI1	0.301	0.326	2.318E-35	518	0.255	0.280	Q68DI1.pdb.gz	ZN776_HUMAN Zinc finger protein 776 OS=Homo sapiens OX=9606 GN=ZNF776 PE=1 SV=2
4	AFDB:Q8WV37	0.296	0.312	4.724E-35	535	0.280	0.297	Q8WV37.pdb.gz	ZN480_HUMAN Zinc finger protein 480 OS=Homo sapiens OX=9606 GN=ZNF480 PE=1 SV=2
5	AFDB:Q9HCX3	0.345	0.299	5.013E-35	659	0.310	0.267	Q9HCX3.pdb.gz	ZN304_HUMAN Zinc finger protein 304 OS=Homo sapiens OX=9606 GN=ZNF304 PE=1 SV=2
6	AFDB:P52742	0.313	0.274	1.221E-34	658	0.308	0.266	P52742.pdb.gz	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
7	AFDB:Q9BS31	0.322	0.359	7.242E-34	505	0.269	0.303	Q9BS31.pdb.gz	ZN649_HUMAN Zinc finger protein 649 OS=Homo sapiens OX=9606 GN=ZNF649 PE=1 SV=1
8	AFDB:A0A0U1RQ46	0.323	0.303	1.097E-33	609	0.243	0.227	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
9	AFDB:Q8N883	0.333	0.324	2.373E-33	585	0.276	0.268	Q8N883.pdb.gz	ZN614_HUMAN Zinc finger protein 614 OS=Homo sapiens OX=9606 GN=ZNF614 PE=1 SV=2
10	AFDB:Q9Y2P0	0.303	0.318	2.518E-33	537	0.259	0.274	Q9Y2P0.pdb.gz	ZN835_HUMAN Zinc finger protein 835 OS=Homo sapiens OX=9606 GN=ZNF835 PE=1 SV=2
11	PDB:3w5kB	0.092	0.270	2.764E-4	110	0.074	0.382	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6o9lQ	0.053	0.066	5.184E-1	430	0.060	0.079	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
13	PDB:7oniH	0.059	0.077	9.958E-1	380	0.049	0.074	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
14	PDB:5khrN	0.057	0.051	1.601	645	0.039	0.034	5khrN.pdb.gz
15	PDB:6nmiC	0.062	0.079	1.601	408	0.067	0.093	6nmiC.pdb.gz	The complete structure of the human TFIIH core complex.
16	PDB:5lj5t	0.040	0.050	1.803	438	0.035	0.046	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
17	PDB:7cunA	0.053	0.045	1.803	730	0.048	0.037	7cunA.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
18	PDB:7o4iW	0.047	0.071	1.913	312	0.058	0.106	7o4iW.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
19	PDB:5c8dE	0.069	0.108	2.154	280	0.030	0.061	5c8dE.pdb.gz	Structural basis for gene regulation by a B12-dependent photoreceptor.
20	PDB:5gm6a	0.036	0.122	2.286	123	0.040	0.187	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T619	0.0	1173	568	1.000	1.000	ZN648_HUMAN Zinc finger protein 648 OS=Homo sapiens OX=9606 GN=ZNF648 PE=1 SV=1
2	Q6ZN57	2.08e-101	316	461	0.301	0.371	ZFP2_HUMAN Zinc finger protein ZFP2 OS=Homo sapiens OX=9606 GN=ZFP2 PE=1 SV=1
3	Q15937	6.03e-101	316	498	0.259	0.295	ZNF79_HUMAN Zinc finger protein 79 OS=Homo sapiens OX=9606 GN=ZNF79 PE=1 SV=2
4	Q8TAQ5	1.64e-99	318	688	0.264	0.218	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
5	Q14585	6.35e-99	310	488	0.250	0.291	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
6	Q8IYB9	7.37e-99	315	648	0.246	0.216	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2
7	Q8TD23	1.62e-98	312	568	0.252	0.252	ZN675_HUMAN Zinc finger protein 675 OS=Homo sapiens OX=9606 GN=ZNF675 PE=1 SV=3
8	Q8NA42	2.77e-98	308	475	0.250	0.299	ZN383_HUMAN Zinc finger protein 383 OS=Homo sapiens OX=9606 GN=ZNF383 PE=1 SV=1
9	P35789	3.85e-98	313	620	0.259	0.237	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
10	Q96RE9	8.92e-98	311	604	0.261	0.245	ZN300_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
11	A0A0A0MS50	1.06e-97	311	604	0.261	0.245	A0A0A0MS50_HUMAN Zinc finger protein 300 OS=Homo sapiens OX=9606 GN=ZNF300 PE=1 SV=1
12	P17020	1.13e-97	313	682	0.255	0.213	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
13	P52742	2.03e-97	312	658	0.262	0.226	ZN135_HUMAN Zinc finger protein 135 OS=Homo sapiens OX=9606 GN=ZNF135 PE=1 SV=3
14	Q8BLA2	3.65e-97	309	578	0.259	0.254	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
15	Q7TMN8	4.15e-97	308	578	0.259	0.254	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
16	Q49A12	4.36e-97	307	536	0.245	0.259	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
17	Q8BLE1	5.69e-97	300	338	0.243	0.408	Q8BLE1_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
18	Q8TBZ5	6.25e-97	307	544	0.275	0.287	ZN502_HUMAN Zinc finger protein 502 OS=Homo sapiens OX=9606 GN=ZNF502 PE=1 SV=1
19	P17097	6.47e-97	311	686	0.271	0.224	ZNF7_HUMAN Zinc finger protein 7 OS=Homo sapiens OX=9606 GN=ZNF7 PE=1 SV=1
20	Q9UJW8	9.23e-97	311	692	0.254	0.208	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07754 HVO_2753_ZBP	2.6	19.2	Small zinc finger protein HVO_2753-like, Zn-binding pocket
2	PF01155 HypA	8.5e+02	11.4	Hydrogenase/urease nickel incorporation, metallochaperone, hypA
3	PF00096 zf-C2H2	6.1e-49	173.0	Zinc finger, C2H2 type
4	PF16622 zf-C2H2_11	7.3e-12	56.1	zinc-finger C2H2-type
5	PF13894 zf-C2H2_4	5.1e-29	109.4	C2H2-type zinc finger
6	PF15909 zf-C2H2_8	53	15.6	C2H2-type zinc ribbon
7	PF16293 zf-C2H2_9	1.4e+02	13.8	C2H2 type zinc-finger (1 copy)
8	PF12171 zf-C2H2_jaz	3.1e-09	48.1	Zinc-finger double-stranded RNA-binding
9	PF05605 zf-Di19	0.14	23.8	Drought induced 19 protein (Di19), zinc-binding
10	PF13465 zf-H2C2_2	6.6e-67	230.4	Zinc-finger double domain
11	PF08790 zf-LYAR	1.5e+02	13.6	LYAR-type C2HC zinc finger
12	PF12874 zf-met	39	16.0	Zinc-finger of C2H2 type
13	PF18439 zf_UBZ	0.00014	32.8	Ubiquitin-Binding Zinc Finger
14	PF17032 zinc_ribbon_15	1.6	20.8	zinc-ribbon family
15	PF14369 zinc_ribbon_9	4e+02	12.7	zinc-ribbon
16	PF09723 Zn-ribbon_8	0.0012	30.2	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000344129

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000380071	0.787	Tigger transposable element-derived protein 7
2	9606.ENSP00000469417	0.730	Kallikrein-9
3	9606.ENSP00000323224	0.602	Olfactory receptor 52N4
4	9606.ENSP00000250351	0.590	Kallikrein-12
5	9606.ENSP00000411096	0.577	ATP binding cassette subfamily A member 13
6	9606.ENSP00000296736	0.517	Tigger transposable element-derived protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.335	heterocyclic compound binding
GO:0097159	0.335	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.992	regulation of biological process
GO:0050794	0.978	regulation of cellular process
GO:0019222	0.812	regulation of metabolic process
GO:0009987	0.776	cellular process
GO:0060255	0.725	regulation of macromolecule metabolic process
GO:0010468	0.701	regulation of gene expression
GO:0009889	0.681	regulation of biosynthetic process
GO:0080090	0.605	regulation of primary metabolic process
GO:0031323	0.603	regulation of cellular metabolic process
GO:0051171	0.516	regulation of nitrogen compound metabolic process
GO:0019219	0.486	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.479	regulation of RNA metabolic process
GO:0031326	0.459	regulation of cellular biosynthetic process
GO:0006355	0.450	regulation of DNA-templated transcription
GO:0048518	0.368	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0031981	0.736	nuclear lumen
GO:0005654	0.679	nucleoplasm
GO:0005737	0.676	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]