StarFunc result for job id Q5T6C5

User Input

>input (722 residues)
MAVRERAAAAMAALERRVPSLDDFAGQSWSSWVERADLPAADGAELEESSKNTKKLDAMT
LIKEDMSIFGHCPAHDDFYLVVCNHCSQVVKPQAFQKHCERRHGPLSKLYGRAPPPPPAP
ASSQKCHVVNGQGPACRAPGSTKTSSREKGQGSRSRGHQPPEKTQKDNLCQPGGLTKDSP
GKPPMAPPSKEPPGRENIEIIPSEGSSHWAEGSPPEKEPSGTRLPPKTHRKMARKECDLN
RQCGVINPETKKICTRLLTCKIHSVHQRREVQGRAKDFDVLVAELKANSRKGESPKEKSP
GRKEQVLERPSQELPSSVQVVAAVAAPSSTFSVRAKQTYPYCALPRSRASSESELDDEGP
CGGDGDPGLFPFPMPRGGTQASSEESEEEGTSDDLHPPPDCHYATRPPRPQAFCTFGSRL
VSPGCYVFSRRLDRFCSALSSMLERHLSTHMWKKIPPAAEPPAHLVNSPLSAPLSPSSTG
TCPRLPGPTLRPACPASMPPTKDNLVPSYPAGSPSVAAACSQAECMGGSQAITSPLPANT
PSPSFSKLPPSKASKSSKGKDGVEVEAPSRKRKLSPGPTTLKRTCILEPTGKGKPSGCRG
LSAKTKTALSMGLNGTMGPRVKRAGPLDCRGSPHQLPTPVKASQLENRGAAGHPAKALPT
NCLSEEEVAKKRKNLATYCRPVKAKHCQAGAPADVACSVRRKKPGPALAFEEKCSTLKSK
AH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9ULK2	0.176	0.154	8.774E-28	861	0.334	0.280	Q9ULK2.pdb.gz	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
2	AFDB:A0A2R8YDD6	0.132	0.113	1.598E-26	892	0.309	0.250	A0A2R8YDD6.pdb.gz	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
3	AFDB:Q8R4I1	0.124	0.106	3.747E-25	867	0.302	0.251	Q8R4I1.pdb.gz	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
4	AFDB:E7F640	0.123	0.109	8.247E-24	866	0.283	0.236	E7F640.pdb.gz	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
5	AFDB:A4D0Q3	0.099	0.094	4.263E-15	759	0.222	0.211	A4D0Q3.pdb.gz	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
6	PDB:7ktrN	0.058	0.496	1.215E-2	53	0.035	0.472	7ktrN.pdb.gz	Structure of the human SAGA coactivator complex.
7	AFDB:Q8GY51	0.057	0.043	1.609E-2	1059	0.169	0.115	Q8GY51.pdb.gz	Q8GY51_ARATH At4g15730 OS=Arabidopsis thaliana OX=3702 GN=DL3905C PE=2 SV=1
8	AFDB:Q9Z2U4	0.050	0.053	1.068E-1	655	0.151	0.166	Q9Z2U4.pdb.gz	ELF4_MOUSE ETS-related transcription factor Elf-4 OS=Mus musculus OX=10090 GN=Elf4 PE=1 SV=2
9	AFDB:Q9VTS9	0.063	0.029	1.212E-1	1900	0.139	0.053	Q9VTS9.pdb.gz	Q9VTS9_DROME Rolling pebbles, isoform B OS=Drosophila melanogaster OX=7227 GN=rols PE=4 SV=2
10	AFDB:Q99607	0.056	0.061	1.291E-1	663	0.151	0.164	Q99607.pdb.gz	ELF4_HUMAN ETS-related transcription factor Elf-4 OS=Homo sapiens OX=9606 GN=ELF4 PE=1 SV=1
11	AFDB:Q8IXT1	0.064	0.054	1.770E-1	998	0.161	0.116	Q8IXT1.pdb.gz	DDIAS_HUMAN DNA damage-induced apoptosis suppressor protein OS=Homo sapiens OX=9606 GN=DDIAS PE=2 SV=2
12	PDB:6t9lN	0.040	0.269	1.890	82	0.025	0.220	6t9lN.pdb.gz	Structure of the transcription coactivator SAGA.
13	PDB:3jcmI	0.037	0.051	8.067	416	0.014	0.024	3jcmI.pdb.gz	The 3.8 angstrom structure of the U4/U6.U5 tri-snRNP: Insights into spliceosome assembly and catalysis
14	PDB:5iy7M	0.030	0.052	8.593	310	0.019	0.045	5iy7M.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
15	PDB:6gawAp	0.031	0.078	8.593	190	0.021	0.079	6gawAp.pdb.gz	Unique features of mammalian mitochondrial translation initiation revealed by cryo-EM.
16	PDB:3mhhC	0.035	0.262	9.152	93	0.007	0.054	3mhhC.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9ULK2	3.12e-45	176	861	0.181	0.152	AT7L1_HUMAN Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=3
2	A4D0Q3	6.91e-39	156	759	0.151	0.144	A4D0Q3_HUMAN KIAA1218 protein OS=Homo sapiens OX=9606 GN=KIAA1218 PE=1 SV=1
3	Q8R4I1	8.56e-29	125	867	0.126	0.105	ATX7_MOUSE Ataxin-7 OS=Mus musculus OX=10090 GN=Atxn7 PE=1 SV=2
4	O15265	3.19e-28	123	892	0.123	0.100	ATX7_HUMAN Ataxin-7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
5	A0A2R8YDD6	3.84e-28	123	892	0.123	0.100	A0A2R8YDD6_HUMAN Ataxin 7 OS=Homo sapiens OX=9606 GN=ATXN7 PE=1 SV=1
6	E7F640	7.86e-28	122	866	0.086	0.072	E7F640_DANRE Ataxin 7 OS=Danio rerio OX=7955 GN=atxn7 PE=4 SV=1
7	Q9BTQ8	1.35e-15	82.8	533	0.058	0.079	Q9BTQ8_HUMAN ATXN7L1 protein OS=Homo sapiens OX=9606 GN=ATXN7L1 PE=1 SV=2
8	P53165	7.53e-06	51.6	657	0.035	0.038	SGF73_YEAST SAGA-associated factor 73 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SGF73 PE=1 SV=1
9	O94397	5.10e-05	48.5	344	0.039	0.081	SGF73_SCHPO SAGA-associated factor 73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sgf73 PE=3 SV=1
10	Q14CW9	0.008	41.6	347	0.026	0.055	AT7L3_HUMAN Ataxin-7-like protein 3 OS=Homo sapiens OX=9606 GN=ATXN7L3 PE=1 SV=1
11	O77375	0.056	39.7	2457	0.033	0.010	O77375_PLAF7 DNA-directed RNA polymerase subunit OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_0318200 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08313 SCA7	3.8e-21	86.1	SCA7, zinc-binding domain
2	PF16135 TDBD	70	14.9	Tify domain binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358886

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000397259	0.838	Ataxin-7-like protein 3
2	9606.ENSP00000316114	0.622	SAGA-associated factor 29
3	9606.ENSP00000261497	0.518	Ubiquitin carboxyl-terminal hydrolase 22

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.360	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.992	regulation of primary metabolic process
GO:0060255	0.992	regulation of macromolecule metabolic process
GO:0051171	0.992	regulation of nitrogen compound metabolic process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0050794	0.988	regulation of cellular process
GO:0031323	0.981	regulation of cellular metabolic process
GO:0048518	0.980	positive regulation of biological process
GO:0010468	0.975	regulation of gene expression
GO:0006807	0.973	nitrogen compound metabolic process
GO:0009987	0.962	cellular process
GO:0043170	0.957	macromolecule metabolic process
GO:0031326	0.946	regulation of cellular biosynthetic process
GO:1903506	0.941	regulation of nucleic acid-templated transcription
GO:0006355	0.877	regulation of DNA-templated transcription
GO:1901564	0.856	organonitrogen compound metabolic process
GO:0006357	0.722	regulation of transcription by RNA polymerase II
GO:0048522	0.668	positive regulation of cellular process
GO:0009893	0.647	positive regulation of metabolic process
GO:0051173	0.634	positive regulation of nitrogen compound metabolic process
GO:0010604	0.628	positive regulation of macromolecule metabolic process
GO:0043412	0.615	macromolecule modification
GO:0036211	0.611	protein modification process
GO:0031325	0.611	positive regulation of cellular metabolic process
GO:0045893	0.481	positive regulation of DNA-templated transcription
GO:0016570	0.474	histone modification
GO:0018394	0.465	peptidyl-lysine acetylation
GO:0006475	0.464	internal protein amino acid acetylation
GO:0048519	0.460	negative regulation of biological process
GO:0044237	0.454	cellular metabolic process
GO:0018393	0.417	internal peptidyl-lysine acetylation
GO:0016573	0.408	histone acetylation
GO:0016578	0.356	histone deubiquitination
GO:1901360	0.331	organic cyclic compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005654	0.998	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005829	0.966	cytosol
GO:0032991	0.889	protein-containing complex
GO:1902494	0.842	catalytic complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]