StarFunc result for job id Q5T6F2

User Input

>input (1119 residues)
MMTSVSSDHCRGAREKPQISAAQSTQPQKQVVQATAEQMRLAQVIFDKNDSDFEAKVKQL
MEVTGKNQDECIVALHDCNGDVNKAINILLEGNSDTTSWETVGCKKKNFAKENSENKENR
EKKSEKESSRGRGNNNRKGRGGNRGREFRGEENGIDCNQVDKPSDRGKRARGRGFGRGRG
RGAGRFSTQGMGTFNPADYSDSTSTDVCGTKLVVWEAAQNGADEGTELASNTHNIAQDLS
NKSSYGLKGAWKNSVEEWTTEDWTEDLSETKVFTASSAPAENHILPGQSIDLVALLQKPV
PHSQASEANSFETSQQQGFGQALVFTNSQHNNQMAPGTGSSTAVNSCSPQSLSSVLGSGF
GELAPPKMANITSSQILDQLKAPSLGQFTTTPSTQQNSTSHPTTTTSWDLKPPTSQSSVL
SHLDFKSQPEPSPVLSQLSQRQQHQSQAVTVPPPGLESFPSQAKLRESTPGDSPSTVNKL
LQLPSTTIENISVSVHQPQPKHIKLAKRRIPPASKIPASAVEMPGSADVTGLNVQFGALE
FGSEPSLSEFGSAPSSENSNQIPISLYSKSLSEPLNTSLSMTSAVQNSTYTTSVITSCSL
TSSSLNSASPVAMSSSYDQSSVHNRIPYQSPVSSSESAPGTIMNGHGGGRSQQTLDTPKT
TGPPSALPSVSSLPSTTSCTALLPSTSQHTGDLTSSPLSQLSSSLSSHQSSLSAHAALSS
STSHTHASVESASSHQSSATFSTAATSVSSSASSGASLSSSMNTANSLCLGGTPASASSS
SSRAAPLVTSGKAPPNLPQGVPPLLHNQYLVGPGGLLPAYPIYGYDELQMLQSRLPVDYY
GIPFAAPTALASRDGSLANNPYPGDVTKFGRGDSASPAPATTPAQPQQSQSQTHHTAQQP
FVNPALPPGYSYTGLPYYTGMPSAFQYGPTMFVPPASAKQHGVNLSTPTPPFQQASGYGQ
HGYSTGYDDLTQGTAAGDYSKGGYAGSSQAPNKSAGSGPGKGVSVSSSTTGLPDMTGSVY
NKTQTFDKQGFHAGTPPPFSLPSVLGSTGPLASGAAPGYAPPPFLHILPAHQQPHSQLLH
HHLPQDAQSGSGQRSQPSSLQPKSQASKPAYGNSPYWTN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T6F2	0.999	0.999	0.000	1119	1.000	1.000	Q5T6F2.pdb.gz	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
2	AFDB:Q80X50	0.095	0.095	9.649E-50	1107	0.478	0.483	Q80X50.pdb.gz	UBP2L_MOUSE Ubiquitin-associated protein 2-like OS=Mus musculus OX=10090 GN=Ubap2l PE=1 SV=1
3	AFDB:Q14157	0.173	0.176	2.633E-49	1087	0.475	0.489	Q14157.pdb.gz	UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2
4	AFDB:Q86S05	0.062	0.053	4.549E-13	1375	0.265	0.216	Q86S05.pdb.gz	LIG_DROME Protein lingerer OS=Drosophila melanogaster OX=7227 GN=lig PE=1 SV=1
5	AFDB:O43024	0.060	0.067	2.874E-4	963	0.186	0.216	O43024.pdb.gz	DEF1_SCHPO RNA polymerase II degradation factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=def1 PE=1 SV=1
6	AFDB:Q8L7T4	0.054	0.056	8.349E-4	848	0.133	0.176	Q8L7T4.pdb.gz	Q8L7T4_ARATH AT3g13990/MDC16_11 OS=Arabidopsis thaliana OX=3702 GN=At3g13990 PE=1 SV=1
7	AFDB:Q0WUY5	0.043	0.056	1.773E-3	841	0.159	0.212	Q0WUY5.pdb.gz	Q0WUY5_ARATH Flocculation protein (DUF1296) OS=Arabidopsis thaliana OX=3702 GN=At3g07660 PE=1 SV=1
8	AFDB:O94913	0.035	0.033	3.118E-3	1555	0.142	0.102	O94913.pdb.gz	PCF11_HUMAN Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3
9	AFDB:Q9CAF4	0.044	0.040	5.838E-3	1309	0.176	0.150	Q9CAF4.pdb.gz	NUP1_ARATH Nuclear pore complex protein NUP1 OS=Arabidopsis thaliana OX=3702 GN=NUP1 PE=1 SV=1
10	AFDB:Q7KMH9	0.039	0.034	7.504E-3	1420	0.169	0.133	Q7KMH9.pdb.gz	Q7KMH9_DROME BcDNA.LD26050 OS=Drosophila melanogaster OX=7227 GN=wde PE=1 SV=1
11	PDB:4f1iA	0.036	0.118	2.594E-1	328	0.010	0.034	4f1iA.pdb.gz
12	PDB:3e46A	0.037	0.203	3.780E-1	202	0.011	0.059	3e46A.pdb.gz
13	PDB:6hivDI	0.032	0.074	6.245E-1	390	0.015	0.044	6hivDI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:6c95D	0.033	0.344	9.099E-1	95	0.010	0.116	6c95D.pdb.gz	Structure of Human NatA and Its Regulation by the Huntingtin Interacting Protein HYPK.
15	PDB:3ihpB	0.033	0.054	1.169	681	0.013	0.021	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
16	PDB:4xb6C	0.037	0.109	1.245	353	0.012	0.037	4xb6C.pdb.gz	Structural insights into the bacterial carbon-phosphorus lyase machinery.
17	PDB:3bq3A	0.042	0.172	1.326	250	0.006	0.028	3bq3A.pdb.gz
18	PDB:3wg6A	0.035	0.113	1.600	299	0.004	0.017	3wg6A.pdb.gz	Crystal structure of conjugated polyketone reductase (CPR-C1) from Candida parapsilosis IFO 0708 complexed with NADPH.
19	PDB:7b5lH	0.038	0.099	2.057	423	0.007	0.019	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
20	PDB:7qwqt	0.032	0.676	2.815	47	0.006	0.149	7qwqt.pdb.gz	Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q14157	0.0	587	1087	0.466	0.479	UBP2L_HUMAN Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2
2	Q5T6F2	0.0	2264	1119	1.000	1.000	UBAP2_HUMAN Ubiquitin-associated protein 2 OS=Homo sapiens OX=9606 GN=UBAP2 PE=1 SV=1
3	Q80X50	2.56e-101	347	1107	0.277	0.280	UBP2L_MOUSE Ubiquitin-associated protein 2-like OS=Mus musculus OX=10090 GN=Ubap2l PE=1 SV=1
4	Q86S05	2.59e-19	97.1	1375	0.081	0.066	LIG_DROME Protein lingerer OS=Drosophila melanogaster OX=7227 GN=lig PE=1 SV=1
5	O61708	1.76e-04	48.1	712	0.031	0.049	O61708_CAEEL Protein lingerer OS=Caenorhabditis elegans OX=6239 GN=pqn-59 PE=1 SV=2
6	Q57W57	0.055	40.4	6062	0.048	0.009	Q57W57_TRYB2 PH domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.28F8.60 PE=4 SV=1
7	Q5B9A9	1.1	35.8	870	0.016	0.021	Q5B9A9_EMENI RNA polymerase II degradation factor 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02871 PE=3 SV=1
8	A0A1D8PGF8	3.0	34.7	1409	0.015	0.012	A0A1D8PGF8_CANAL Msb2p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MSB2 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05918 API5	47	14.3	Apoptosis inhibitory protein 5 (API5)
2	PF02845 CUE	4.2e+02	12.1	CUE domain
3	PF07423 DUF1510	21	16.7	Domain of unknown function (DUF1510)
4	PF12478 DUF3697	1.5e-13	61.9	Ubiquitin-associated protein 2
5	PF06972 GIP1_N	4.1	18.9	GBF-interacting protein 1 N-terminal
6	PF06109 HlyE	2.4e+02	12.4	Haemolysin E (HlyE)
7	PF16678 HOIP-UBA	4.5e+02	12.1	HOIP UBA domain pair
8	PF13679 Methyltransf_32	3.2e+02	12.7	Methyltransferase domain
9	PF00627 UBA	3.2e+02	12.6	UBA/TS-N domain
10	PF14555 UBA_4	3.8	18.7	UBA-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368540

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000377681	0.813	Ras GTPase-activating protein-binding protein 1
2	9606.ENSP00000265069	0.801	Zinc finger RNA-binding protein
3	9606.ENSP00000348959	0.708	Mannosyl-oligosaccharide 1,2-alpha-mannosidase IB
4	9606.ENSP00000358363	0.688	Myomegalin
5	9606.ENSP00000389445	0.674	Ubiquitin-associated protein 2-like
6	9606.ENSP00000350170	0.670	Fragile X mental retardation syndrome-related protein 1
7	9606.ENSP00000364550	0.662	Lysine-specific demethylase 5C
8	9606.ENSP00000386738	0.660	E3 ubiquitin-protein ligase KCMF1
9	9606.ENSP00000340329	0.641	Caprin-1
10	9606.ENSP00000321997	0.635	La-related protein 1B
11	9606.ENSP00000338629	0.629	Arginine-glutamic acid dipeptide repeats protein
12	9606.ENSP00000420294	0.626	Polyhomeotic-like protein 3
13	9606.ENSP00000376097	0.622	Unconventional prefoldin RPB5 interactor 1
14	9606.ENSP00000380718	0.616	Chromodomain Y-like protein
15	9606.ENSP00000351416	0.613	Ankyrin repeat domain-containing protein 17
16	9606.ENSP00000250113	0.610	Fragile X mental retardation syndrome-related protein 2
17	9606.ENSP00000328854	0.596	Nucleolar complex protein 4 homolog
18	9606.ENSP00000352738	0.591	Ras GTPase-activating protein-binding protein 2
19	9606.ENSP00000382328	0.584	NEDD4 binding protein 2 like 2
20	9606.ENSP00000359506	0.577	Synaptic functional regulator FMR1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0045296	1.000	cadherin binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0042592	0.979	homeostatic process
GO:0048872	0.949	homeostasis of number of cells
GO:0061484	0.938	hematopoietic stem cell homeostasis
GO:0032502	0.669	developmental process
GO:0071840	0.663	cellular component organization or biogenesis
GO:0016043	0.577	cellular component organization
GO:0044085	0.407	cellular component biogenesis
GO:0022607	0.392	cellular component assembly
GO:0006996	0.370	organelle organization
GO:0000003	0.336	reproduction
GO:0140694	0.328	non-membrane-bounded organelle assembly
GO:0022414	0.303	reproductive process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0032991	0.999	protein-containing complex
GO:0140513	0.989	nuclear protein-containing complex
GO:0005737	0.975	cytoplasm
GO:0031519	0.934	PcG protein complex
GO:0005829	0.822	cytosol
GO:0070013	0.605	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]