StarFunc result for job id Q5T6J7

User Input

>input (187 residues)
MAAPGALLVMGVSGSGKSTVGALLASELGWKFYDADDYHPEENRRKMGKGIPLNDQDRIP
WLCNLHDILLRDVASGQRVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLL
VVHLSGSFEVISGRLLKREGHFMPPELLQSQFETLEPPAAPENFIQISVDKNVSEIIATI
METLKMK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P39208	0.839	0.839	2.804E-18	187	0.364	0.364	P39208.pdb.gz	IDNK_ECOLI Thermosensitive gluconokinase OS=Escherichia coli (strain K12) OX=83333 GN=idnK PE=3 SV=1
2	AFDB:P46859	0.802	0.854	3.253E-17	175	0.374	0.400	P46859.pdb.gz	GNTK_ECOLI Thermoresistant gluconokinase OS=Escherichia coli (strain K12) OX=83333 GN=gntK PE=1 SV=4
3	PDB:1ko5A	0.782	0.845	8.616E-17	172	0.369	0.401	1ko5A.pdb.gz	Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
4	AFDB:Q6FM38	0.805	0.822	2.107E-14	183	0.332	0.339	Q6FM38.pdb.gz	Q6FM38_CANGA Gluconokinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K11297g PE=3 SV=1
5	AFDB:Q10242	0.777	0.754	3.484E-14	193	0.321	0.311	Q10242.pdb.gz	GNTK_SCHPO Probable gluconokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.12 PE=3 SV=1
6	AFDB:Q03786	0.764	0.742	4.881E-13	193	0.326	0.316	Q03786.pdb.gz	GNTK_YEAST Probable gluconokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR248C PE=1 SV=1
7	AFDB:O50274	0.599	0.203	3.180E-7	633	0.182	0.054	O50274.pdb.gz	CYSNC_PSEAE Bifunctional enzyme CysN/CysC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=cysNC PE=3 SV=1
8	AFDB:P0A6J1	0.610	0.572	3.606E-7	201	0.182	0.169	P0A6J1.pdb.gz	CYSC_ECOLI Adenylyl-sulfate kinase OS=Escherichia coli (strain K12) OX=83333 GN=cysC PE=1 SV=2
9	AFDB:Q92203	0.615	0.564	4.089E-7	206	0.203	0.184	Q92203.pdb.gz	KAPS_EMENI Adenylyl-sulfate kinase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=sD PE=3 SV=2
10	AFDB:Q10313	0.656	0.174	6.760E-7	787	0.155	0.037	Q10313.pdb.gz	TRNL_SCHPO tRNA ligase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=trl1 PE=3 SV=2
11	PDB:1xjqB	0.656	0.229	7.427E-7	590	0.171	0.054	1xjqB.pdb.gz	The crystal structure of human PAPS synthetase 1 reveals asymmetry in substrate binding
12	AFDB:P0A6D7	0.511	0.548	7.665E-7	173	0.209	0.225	P0A6D7.pdb.gz	AROK_ECOLI Shikimate kinase 1 OS=Escherichia coli (strain K12) OX=83333 GN=aroK PE=1 SV=2
13	PDB:1m7gC	0.588	0.532	1.083E-6	209	0.150	0.134	1m7gC.pdb.gz	Ligand-Induced Structural Changes in Adenosine 5'-Phosphosulfate Kinase from Penicillium chrysogenum.
14	PDB:1ukyA	0.619	0.594	1.790E-6	196	0.144	0.138	1ukyA.pdb.gz	Substrate specificity and assembly of the catalytic center derived from two structures of ligated uridylate kinase.
15	PDB:1qf9A	0.514	0.498	4.596E-6	194	0.182	0.175	1qf9A.pdb.gz	pH influences fluoride coordination number of the AlFx phosphoryl transfer transition state analog.
16	PDB:3iijA	0.533	0.565	6.293E-6	175	0.193	0.206	3iijA.pdb.gz	hCINAP is an atypical mammalian nuclear adenylate kinase with an ATPase motif: Structural and functional studies.
17	PDB:2c95A	0.658	0.635	7.136E-6	195	0.155	0.149	2c95A.pdb.gz	Structure of Adenylate Kinase 1 in Complex with P1, P4-Di(Adenosine)Tetraphosphate
18	PDB:1d6jB	0.544	0.558	1.517E-5	182	0.160	0.165	1d6jB.pdb.gz
19	PDB:2cdnA	0.596	0.599	1.615E-5	186	0.150	0.151	2cdnA.pdb.gz	The Crystal Structure of Mycobacterium Tuberculosis Adenylate Kinase in Complex with Two Molecules of Adp and Mg2+ Supports an Associative Mechanism for Phosphoryl Transfer.
20	PDB:2vp4D	0.449	0.425	1.615E-5	199	0.182	0.171	2vp4D.pdb.gz	Structural Studies of Nucleoside Analog and Feedback Inhibitor Binding to Drosophila Melanogaster Multisubstrate Deoxyribonucleoside Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P39208	6.91e-38	130	187	0.364	0.364	IDNK_ECOLI Thermosensitive gluconokinase OS=Escherichia coli (strain K12) OX=83333 GN=idnK PE=3 SV=1
2	P46859	3.18e-36	126	175	0.358	0.383	GNTK_ECOLI Thermoresistant gluconokinase OS=Escherichia coli (strain K12) OX=83333 GN=gntK PE=1 SV=4
3	Q10242	2.13e-27	103	193	0.332	0.321	GNTK_SCHPO Probable gluconokinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4G9.12 PE=3 SV=1
4	Q6FM38	3.11e-23	93.2	183	0.337	0.344	Q6FM38_CANGA Gluconokinase OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0K11297g PE=3 SV=1
5	Q03786	1.27e-22	91.7	193	0.316	0.306	GNTK_YEAST Probable gluconokinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YDR248C PE=1 SV=1
6	P0A6D7	0.008	37.7	173	0.086	0.092	AROK_ECOLI Shikimate kinase 1 OS=Escherichia coli (strain K12) OX=83333 GN=aroK PE=1 SV=2
7	Q8GY88	0.011	37.7	300	0.075	0.047	SK2_ARATH Shikimate kinase 2, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=SK2 PE=1 SV=1
8	Q7X7H9	0.012	37.7	287	0.080	0.052	SK3_ORYSJ Shikimate kinase 3, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SK3 PE=1 SV=2
9	Q5NTH3	0.014	37.7	307	0.128	0.078	SK2_ORYSJ Shikimate kinase 2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SK2 PE=1 SV=1
10	F4IIJ2	0.024	37.0	304	0.075	0.046	F4IIJ2_ARATH shikimate kinase OS=Arabidopsis thaliana OX=3702 GN=SK1 PE=1 SV=1
11	F4JW33	0.025	37.0	308	0.075	0.045	F4JW33_ARATH shikimate kinase OS=Arabidopsis thaliana OX=3702 GN=SK2 PE=1 SV=1
12	Q5NTH4	0.030	36.6	308	0.075	0.045	SK1_ORYSJ Shikimate kinase 1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=SK1 PE=1 SV=1
13	Q9P7R0	0.080	35.8	1573	0.064	0.008	ARO1_SCHPO Pentafunctional AROM polypeptide OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=aro1 PE=1 SV=1
14	Q38EC4	0.15	34.3	200	0.091	0.085	Q38EC4_TRYB2 Adenylate kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.0350 PE=3 SV=1
15	P9WPY3	0.22	33.5	176	0.102	0.108	AROK_MYCTU Shikimate kinase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=aroK PE=1 SV=1
16	P0A6E1	0.37	33.1	174	0.075	0.080	AROL_ECOLI Shikimate kinase 2 OS=Escherichia coli (strain K12) OX=83333 GN=aroL PE=1 SV=3
17	G5EFR8	0.55	33.1	720	0.080	0.021	G5EFR8_CAEEL AAA+ ATPase domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=prx-6 PE=1 SV=1
18	E9Q0B6	1.1	32.3	4144	0.107	0.005	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
19	E9Q3H7	1.1	32.3	4092	0.107	0.005	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
20	F4JD96	1.2	31.6	207	0.080	0.072	F4JD96_ARATH Ribosomal protein L13 family protein OS=Arabidopsis thaliana OX=3702 GN=At3g07110 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13191 AAA_16	67	15.3	AAA ATPase domain
2	PF13207 AAA_17	54	15.6	AAA domain
3	PF13238 AAA_18	0.76	21.8	AAA domain
4	PF13401 AAA_22	64	15.3	AAA domain
5	PF13555 AAA_29	78	14.4	P-loop containing region of AAA domain
6	PF13671 AAA_33	0.54	21.9	AAA domain
7	PF00005 ABC_tran	2.4e+02	13.6	ABC transporter
8	PF01583 APS_kinase	49	15.3	Adenylylsulphate kinase
9	PF02224 Cytidylate_kin	11	17.3	Cytidylate kinase
10	PF13189 Cytidylate_kin2	1.5e+02	14.0	Cytidylate kinase-like family
11	PF01712 dNK	62	14.9	Deoxynucleoside kinase
12	PF09848 DUF2075	3e+02	12.0	Schlafen group 3, DNA/RNA helicase domain
13	PF08433 KTI12	60	14.5	Chromatin associated protein KTI12
14	PF01202 SKI	1.9e-08	46.0	Shikimate kinase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365601

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270776	0.994	6-phosphogluconate dehydrogenase, decarboxylating
2	9606.ENSP00000473348	0.973	GDH/6PGL endoplasmic bifunctional protein
3	9606.ENSP00000380365	0.958	Regucalcin
4	9606.ENSP00000252603	0.930	6-phosphogluconolactonase
5	9606.ENSP00000223366	0.720	Glucokinase
6	9606.ENSP00000357288	0.714	Ragulator complex protein LAMTOR2
7	9606.ENSP00000377192	0.657	Glucose-6-phosphate 1-dehydrogenase
8	9606.ENSP00000365576	0.594	Ubiquilin-1
9	9606.ENSP00000357292	0.574	Ubiquilin-4
10	9606.ENSP00000321259	0.569	Transaldolase
11	9606.ENSP00000307423	0.562	Alpha-1,6-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase
12	9606.ENSP00000306817	0.555	Ribokinase
13	9606.ENSP00000369531	0.528	Ubiquilin-like protein
14	9606.ENSP00000347997	0.518	Ubiquilin-3
15	9606.ENSP00000352401	0.513	Ribulose-phosphate 3-epimerase
16	9606.ENSP00000283646	0.508	Ribose 5-phosphate isomerase A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016301	1.000	kinase activity
GO:0016773	0.996	phosphotransferase activity, alcohol group as acceptor
GO:0005488	0.976	binding
GO:0005515	0.933	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0006807	0.995	nitrogen compound metabolic process
GO:1901360	0.989	organic cyclic compound metabolic process
GO:0006725	0.986	cellular aromatic compound metabolic process
GO:0046483	0.983	heterocycle metabolic process
GO:0034641	0.982	cellular nitrogen compound metabolic process
GO:0006793	0.977	phosphorus metabolic process
GO:0055086	0.970	nucleobase-containing small molecule metabolic process
GO:0019637	0.958	organophosphate metabolic process
GO:1901135	0.948	carbohydrate derivative metabolic process
GO:0006796	0.946	phosphate-containing compound metabolic process
GO:0006753	0.933	nucleoside phosphate metabolic process
GO:0043436	0.860	oxoacid metabolic process
GO:0072521	0.860	purine-containing compound metabolic process
GO:0009117	0.858	nucleotide metabolic process
GO:0019752	0.659	carboxylic acid metabolic process
GO:0006163	0.628	purine nucleotide metabolic process
GO:0005975	0.567	carbohydrate metabolic process
GO:0044282	0.505	small molecule catabolic process
GO:1901575	0.457	organic substance catabolic process
GO:0032787	0.407	monocarboxylic acid metabolic process
GO:1901576	0.371	organic substance biosynthetic process
GO:0051156	0.345	glucose 6-phosphate metabolic process
GO:0046496	0.330	nicotinamide nucleotide metabolic process
GO:0006091	0.329	generation of precursor metabolites and energy
GO:0044248	0.315	cellular catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043226	0.991	organelle
GO:0043227	0.973	membrane-bounded organelle
GO:0043229	0.932	intracellular organelle
GO:0043231	0.910	intracellular membrane-bounded organelle
GO:0031982	0.628	vesicle
GO:0031974	0.467	membrane-enclosed lumen
GO:0070013	0.462	intracellular organelle lumen
GO:0070062	0.440	extracellular exosome
GO:0005634	0.394	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	0.996	Phosphotransferases with an alcohol group as acceptor.

[back to server]