StarFunc result for job id Q5T6R2

User Input

>input (138 residues)
MPAAFPCVFPPQSLQVFPQMIVKVWEKQSLPLPGLRGSPVERLYLPRNELDNPHKQKAWK
IYPPEFAVEILFGMVSVDSLLFVLSSPHWWLHLAQGSFWMSEGGFSLCHPGWSVVAQSLL
TSTSAFCVRAILLPQPPE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P9WK77	0.350	0.277	1.286E-1	187	0.116	0.086	P9WK77.pdb.gz	LPPJ_MYCTU Putative lipoprotein LppJ OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=lppJ PE=1 SV=1
2	PDB:4lgwA	0.213	0.139	1.907E-1	238	0.152	0.088	4lgwA.pdb.gz
3	AFDB:Q9LTS4	0.181	0.077	3.704E-1	466	0.080	0.024	Q9LTS4.pdb.gz	BH041_ARATH Putative transcription factor bHLH041 OS=Arabidopsis thaliana OX=3702 GN=BHLH41 PE=3 SV=1
4	AFDB:P25061	0.249	0.205	5.928E-1	174	0.080	0.063	P25061.pdb.gz	GSPM_PSEAE Type II secretion system protein M OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=xcpZ PE=1 SV=1
5	AFDB:Q9FYE6	0.206	0.134	5.928E-1	240	0.094	0.054	Q9FYE6.pdb.gz	BH101_ARATH Transcription factor bHLH101 OS=Arabidopsis thaliana OX=3702 GN=BHLH101 PE=1 SV=1
6	PDB:3sf5B	0.168	0.107	7.369E-1	261	0.087	0.046	3sf5B.pdb.gz
7	PDB:6jauA	0.174	0.095	8.289E-1	283	0.080	0.039	6jauA.pdb.gz	Molecular basis of the lipid-induced MucA-MucB dissociation in Pseudomonas aeruginosa.
8	PDB:1bibA	0.230	0.138	9.887E-1	294	0.043	0.020	1bibA.pdb.gz	Escherichia coli biotin holoenzyme synthetase/bio repressor crystal structure delineates the biotin- and DNA-binding domains.
9	PDB:6fadC	0.219	0.107	1.049	359	0.029	0.011	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
10	AFDB:Q4QNA8	0.273	0.228	1.067	173	0.058	0.046	Q4QNA8.pdb.gz	Q4QNA8_HAEI8 Competence protein C OS=Haemophilus influenzae (strain 86-028NP) OX=281310 GN=comC PE=4 SV=1
11	AFDB:Q9HZ34	0.177	0.071	1.067	445	0.116	0.036	Q9HZ34.pdb.gz	Q9HZ34_PSEAE histidine kinase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA3206 PE=4 SV=1
12	PDB:1w66A	0.245	0.180	1.251	218	0.058	0.037	1w66A.pdb.gz	The Mycobacterium Tuberculosis Lipb Enzyme Functions as a Cysteine/Lysine Dyad Acyltransferase.
13	PDB:4dibA	0.205	0.114	1.251	323	0.072	0.031	4dibA.pdb.gz
14	PDB:7nfcC	0.182	0.070	1.251	477	0.065	0.019	7nfcC.pdb.gz	Cryo-EM of NHEJ supercomplexes provides insights into DNA repair.
15	PDB:2rsvA	0.157	0.070	1.327	403	0.051	0.017	2rsvA.pdb.gz
16	PDB:2bujA	0.239	0.132	1.407	291	0.043	0.021	2bujA.pdb.gz	Crystal Structure of the Human Serine-Threonine Kinase 16 in Complex with Staurosporine
17	AFDB:P06709	0.232	0.124	1.432	321	0.022	0.009	P06709.pdb.gz	BIRA_ECOLI Bifunctional ligase/repressor BirA OS=Escherichia coli (strain K12) OX=83333 GN=birA PE=1 SV=1
18	AFDB:Q75GI1	0.193	0.092	1.432	359	0.051	0.019	Q75GI1.pdb.gz	Q75GI1_ORYSJ Helix-loop-helix DNA-binding domain containing protein, expressed OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os03g51580 PE=2 SV=1
19	AFDB:Q8IEG9	0.207	0.099	1.432	408	0.051	0.017	Q8IEG9.pdb.gz	LIPLA_PLAF7 Lipoate--protein ligase 1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=LipL1 PE=1 SV=1
20	AFDB:Q2QLR0	0.198	0.099	1.518	338	0.051	0.021	Q2QLR0.pdb.gz	Q2QLR0_ORYSJ Helix-loop-helix DNA-binding domain containing protein OS=Oryza sativa subsp. japonica OX=39947 GN=LOC_Os12g43620 PE=3 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6XPS3	2.55e-15	73.6	522	0.225	0.059	TPTE2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Homo sapiens OX=9606 GN=TPTE2 PE=1 SV=2
2	P56180	3.50e-11	61.6	551	0.210	0.053	TPTE_HUMAN Putative tyrosine-protein phosphatase TPTE OS=Homo sapiens OX=9606 GN=TPTE PE=1 SV=3
3	A0A2R8Y645	1.38e-06	48.5	716	0.152	0.029	A0A2R8Y645_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DDX3X PE=1 SV=1
4	A0A1W2PQY8	2.01e-06	47.8	565	0.152	0.037	A0A1W2PQY8_HUMAN Malic enzyme OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1
5	Q8IY40	7.86e-06	46.2	353	0.167	0.065	Q8IY40_HUMAN GRIK2 protein OS=Homo sapiens OX=9606 GN=GRIK2 PE=1 SV=1
6	F1QG29	1.36e-05	45.4	511	0.130	0.035	F1QG29_DANRE Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 isoform X1 OS=Danio rerio OX=7955 GN=tpip PE=3 SV=1
7	Q4V9E4	1.36e-05	45.4	511	0.130	0.035	Q4V9E4_DANRE Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase TPTE2 OS=Danio rerio OX=7955 GN=wu:fd20e11 PE=2 SV=1
8	A0A2R8Y5D3	2.35e-05	44.7	343	0.159	0.064	A0A2R8Y5D3_HUMAN DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1
9	G3V3R6	3.88e-04	40.8	233	0.145	0.086	G3V3R6_HUMAN Galectin OS=Homo sapiens OX=9606 GN=LGALS3 PE=1 SV=1
10	Q9BU27	0.014	34.7	70	0.123	0.243	Q9BU27_HUMAN FAM3 metabolism regulating signaling molecule A OS=Homo sapiens OX=9606 GN=FAM3A PE=1 SV=1
11	A0A087WZY1	0.46	32.0	265	0.123	0.064	A0A087WZY1_HUMAN Uncharacterized protein OS=Homo sapiens OX=9606 PE=1 SV=1
12	Q8T9S7	0.94	31.6	533	0.087	0.023	PTEN_DICDI Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Dictyostelium discoideum OX=44689 GN=pteN PE=2 SV=1
13	C9JMN1	1.8	30.8	740	0.109	0.020	C9JMN1_HUMAN Structural maintenance of chromosomes 6 (Fragment) OS=Homo sapiens OX=9606 GN=SMC6 PE=1 SV=1
14	B8XSI6	2.5	30.0	403	0.087	0.030	B8XSI6_PIG Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Sus scrofa OX=9823 GN=PTEN PE=2 SV=1
15	F6KD01	2.5	30.0	403	0.087	0.030	F6KD01_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=2 SV=1
16	O08586	2.5	30.0	403	0.087	0.030	PTEN_MOUSE Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Mus musculus OX=10090 GN=Pten PE=1 SV=1
17	O54857	2.5	30.0	403	0.087	0.030	PTEN_RAT Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Rattus norvegicus OX=10116 GN=Pten PE=1 SV=1
18	P60484	2.5	30.0	403	0.087	0.030	PTEN_HUMAN Phosphatidylinositol 3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN OS=Homo sapiens OX=9606 GN=PTEN PE=1 SV=1
19	A0T2N3	2.6	30.0	359	0.145	0.056	APJB_DANRE Apelin receptor B OS=Danio rerio OX=7955 GN=aplnrb PE=1 SV=1
20	O13787	3.1	29.6	273	0.217	0.110	SEC62_SCHPO Translocation protein sec62 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec62 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10409 PTEN_C2	0.0041	28.3	C2 domain of PTEN tumour-suppressor protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000005942

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000016219	0.582	Cyclin G associated kinase
2	9601.ENSPPYP00000009891	0.577	Clathrin heavy chain
3	9601.ENSPPYP00000012913	0.577	Clathrin heavy chain
4	9601.ENSPPYP00000013842	0.577	Clathrin heavy chain linker domain containing 1
5	9601.ENSPPYP00000002681	0.524	Discs, large homolog 5 (Drosophila)
6	9601.ENSPPYP00000017169	0.524	PDZ domain containing 2
7	9601.ENSPPYP00000008923	0.523	Cellular tumor antigen p53
8	9601.ENSPPYP00000002213	0.513	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit delta
9	9601.ENSPPYP00000015827	0.513	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit beta
10	9601.ENSPPYP00000020059	0.513	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
11	9601.ENSPPYP00000023529	0.513	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit alpha

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.997	catalytic activity
GO:0016787	0.610	hydrolase activity
GO:0016788	0.367	hydrolase activity, acting on ester bonds

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.790	regulation of cellular process
GO:0009987	0.407	cellular process
GO:0050896	0.363	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0005829	0.862	cytosol
GO:0005634	0.858	nucleus
GO:0005654	0.378	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.610	Hydrolases.
EC:3.1.-.-	0.367	Acting on ester bonds.

[back to server]