StarFunc result for job id Q5T764

User Input

>input (474 residues)
MSEESDGKLIEDSLIQLRCHFTWKLLIEAPEIPDLENRIWEEIQFLDTKYNVGIHNLLAY
VKHLKGQNEEALVSLKKAEDLIQKEHANQADIRSLVTWGNFAWVYYHMGRLAEAQTYLDK
VENTCKKFANPSRYRMECPEVDCEEGWALAKCGGKNYERAKTCFEKALEGNPENPEFNTG
YAITVYRLDKFNTASGRNKAFSLHVLKRAVRLNPDDVYIRVLLALKLQDEGQEAEGEKYI
EEALTSISSQAYVFQYAAKFYRRKGSVDKALELLKMALETTPTSAFLHHQMGLCYRAQMI
QIKEATNWQPRGQDRETVDRLVQLAICKFEKTIMLKRTFEMAYVDLAETYAEIGHHRKAE
EHFQKGLRMKIFEDQLKQEIHYHYGRFQEHHGKSQDKAITHYLKGLKIEKMSHSREKLLN
ALEKLAKRCIHQNVRVVESVSLLGLIHKLKGEVSDALLCYERALRLAADLNPIF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T764	1.000	1.000	8.730E-59	474	1.000	1.000	Q5T764.pdb.gz	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
2	AFDB:P09914	0.937	0.929	3.598E-42	478	0.673	0.667	P09914.pdb.gz	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
3	PDB:5udkA	0.910	0.935	4.493E-39	461	0.660	0.679	5udkA.pdb.gz	Structure of human IFIT1 with capped RNA reveals adaptable mRNA binding and mechanisms for sensing N1 and N2 ribose 2'-O methylations.
4	AFDB:Q64282	0.933	0.954	1.490E-37	463	0.565	0.579	Q64282.pdb.gz	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
5	AFDB:Q13325	0.898	0.883	2.399E-36	482	0.540	0.531	Q13325.pdb.gz	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
6	PDB:5w5iC	0.865	0.938	1.595E-35	436	0.622	0.677	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding
7	PDB:4horA	0.881	0.867	2.017E-34	482	0.549	0.539	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
8	AFDB:Q8IZ03	0.770	0.756	4.905E-29	484	0.439	0.430	Q8IZ03.pdb.gz	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
9	AFDB:Q64112	0.722	0.725	1.493E-26	472	0.378	0.379	Q64112.pdb.gz	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	AFDB:O14879	0.720	0.698	3.743E-25	490	0.443	0.429	O14879.pdb.gz	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
11	AFDB:E7FBH4	0.896	0.881	5.560E-24	482	0.333	0.328	E7FBH4.pdb.gz	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
12	PDB:4g1tB	0.587	0.635	8.333E-24	429	0.422	0.466	4g1tB.pdb.gz
13	AFDB:Q64345	0.618	0.718	1.029E-19	403	0.329	0.387	Q64345.pdb.gz	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
14	AFDB:A0A068FR04	0.664	0.718	4.502E-17	433	0.247	0.270	A0A068FR04.pdb.gz	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
15	PDB:7ntfA	0.456	0.260	3.322E-8	918	0.160	0.083	7ntfA.pdb.gz
16	PDB:7qdrB	0.353	0.161	8.057E-8	1212	0.169	0.066	7qdrB.pdb.gz
17	PDB:7qe7J	0.438	0.412	9.466E-8	510	0.169	0.157	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
18	PDB:5dseA	0.438	0.395	2.296E-7	537	0.188	0.166	5dseA.pdb.gz
19	PDB:4bujB	0.381	0.159	2.923E-7	1367	0.143	0.050	4bujB.pdb.gz
20	PDB:7dkhI	0.441	0.254	3.168E-7	914	0.148	0.077	7dkhI.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P09914	0.0	662	478	0.673	0.667	IFIT1_HUMAN Interferon-induced protein with tetratricopeptide repeats 1 OS=Homo sapiens OX=9606 GN=IFIT1 PE=1 SV=2
2	Q13325	0.0	523	482	0.544	0.535	IFIT5_HUMAN Interferon-induced protein with tetratricopeptide repeats 5 OS=Homo sapiens OX=9606 GN=IFIT5 PE=1 SV=1
3	Q5T764	0.0	985	474	1.000	1.000	IFT1B_HUMAN Interferon-induced protein with tetratricopeptide repeats 1B OS=Homo sapiens OX=9606 GN=IFIT1B PE=1 SV=1
4	Q64282	0.0	542	463	0.574	0.587	IFIT1_MOUSE Interferon-induced protein with tetratricopeptide repeats 1 OS=Mus musculus OX=10090 GN=Ifit1 PE=1 SV=2
5	O14879	3.55e-132	393	490	0.460	0.445	IFIT3_HUMAN Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1
6	Q5T765	3.55e-132	393	490	0.460	0.445	Q5T765_HUMAN Interferon-induced protein with tetratricopeptide repeats 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=IFIT3 PE=2 SV=1
7	P09913	6.55e-123	369	472	0.443	0.445	IFIT2_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=1
8	Q8IZ03	1.70e-122	368	484	0.443	0.434	Q8IZ03_HUMAN Interferon-induced protein with tetratricopeptide repeats 2 OS=Homo sapiens OX=9606 GN=IFIT2 PE=1 SV=2
9	Q64112	3.94e-111	338	472	0.388	0.390	IFIT2_MOUSE Interferon-induced protein with tetratricopeptide repeats 2 OS=Mus musculus OX=10090 GN=Ifit2 PE=1 SV=1
10	Q64345	7.15e-91	284	403	0.346	0.407	IFIT3_MOUSE Interferon-induced protein with tetratricopeptide repeats 3 OS=Mus musculus OX=10090 GN=Ifit3 PE=1 SV=1
11	E7FBH4	1.01e-81	263	482	0.342	0.336	E7FBH4_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT12B PE=2 SV=1
12	A0A068FR04	1.53e-37	144	433	0.249	0.273	A0A068FR04_DANRE Interferon-induced protein with tetratricopeptide repeats OS=Danio rerio OX=7955 GN=IFIT17A PE=2 SV=1
13	Q7KJA9	7.24e-07	54.3	1059	0.171	0.076	Q7KJA9_DROME protein O-GlcNAc transferase OS=Drosophila melanogaster OX=7227 GN=sxc PE=1 SV=1
14	Q9Y148	7.61e-07	54.3	1011	0.171	0.080	Q9Y148_DROME protein O-GlcNAc transferase (Fragment) OS=Drosophila melanogaster OX=7227 GN=sxc PE=2 SV=1
15	Q5GA13	8.76e-07	53.9	1062	0.184	0.082	Q5GA13_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
16	Q5GA12	1.06e-06	53.9	1052	0.184	0.083	Q5GA12_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
17	Q5GA10	1.08e-06	53.9	1036	0.184	0.084	Q5GA10_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
18	Q5GA11	1.23e-06	53.5	1046	0.184	0.083	Q5GA11_DANRE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Danio rerio OX=7955 GN=wu:fc12b01 PE=1 SV=1
19	P56558	3.91e-06	52.0	1036	0.179	0.082	OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus OX=10116 GN=Ogt PE=1 SV=1
20	P81436	4.02e-06	52.0	1046	0.181	0.082	OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus OX=9986 GN=OGT PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12895 ANAPC3	0.18	23.4	Anaphase-promoting complex, cyclosome, subunit 3
2	PF14853 Fis1_TPR_C	4.4e+02	12.5	Fis1 C-terminal tetratricopeptide repeat
3	PF17014 Mad3_BUB1_I_2	13	17.3	Putative Mad3/BUB1 like region 1 protein
4	PF12569 NatA_aux_su	0.47	21.0	N-terminal acetyltransferase A, auxiliary subunit
5	PF10602 RPN7	33	15.7	26S proteasome subunit RPN7
6	PF12931 Sec16_C	2.7	19.2	Sec23-binding domain of Sec16
7	PF17574 TA_inhibitor	2.9e+02	12.9	Inhibitor of toxin/antitoxin system (Gp4.5)
8	PF20308 TPR-S	0.75	21.7	Tetratricopeptide Repeats-Sensor
9	PF00515 TPR_1	1.1e-14	64.7	Tetratricopeptide repeat
10	PF13374 TPR_10	0.045	24.9	Tetratricopeptide repeat
11	PF13414 TPR_11	1.3e-16	71.3	TPR repeat
12	PF13424 TPR_12	8.1e-15	66.2	Tetratricopeptide repeat
13	PF13428 TPR_14	6.5e-15	65.5	Tetratricopeptide repeat
14	PF13429 TPR_15	5e-05	34.4	Tetratricopeptide repeat
15	PF13432 TPR_16	0.0011	30.7	Tetratricopeptide repeat
16	PF13431 TPR_17	3.6e-10	50.6	Tetratricopeptide repeat
17	PF14559 TPR_19	3.8e-11	54.6	Tetratricopeptide repeat
18	PF07719 TPR_2	3.5e-17	72.1	Tetratricopeptide repeat
19	PF14561 TPR_20	9	18.0	Tetratricopeptide repeat
20	PF07721 TPR_4	27	16.7	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360874

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000233057	0.845	Interferon-induced, double-stranded RNA-activated protein kinase
2	9606.ENSP00000257570	0.830	2'-5'-oligoadenylate synthase-like protein
3	9606.ENSP00000220849	0.820	Eukaryotic translation initiation factor 3 subunit E
4	9606.ENSP00000307235	0.820	Eukaryotic translation initiation factor 2-alpha kinase 3
5	9606.ENSP00000199389	0.804	Eukaryotic translation initiation factor 2-alpha kinase 1
6	9606.ENSP00000263791	0.804	eIF-2-alpha kinase GCN2
7	9606.ENSP00000360869	0.803	Interferon-induced protein with tetratricopeptide repeats 1
8	9606.ENSP00000381601	0.746	Interferon-induced GTP-binding protein Mx1
9	9606.ENSP00000371471	0.709	Radical S-adenosyl methionine domain-containing protein 2
10	9606.ENSP00000451851	0.630	Interferon alpha inducible protein 27 like 1
11	9606.ENSP00000256722	0.618	UMP-CMP kinase 2, mitochondrial
12	9606.ENSP00000414922	0.614	Putative ubiquitin carboxyl-terminal hydrolase 41
13	9606.ENSP00000215794	0.593	Ubl carboxyl-terminal hydrolase 18
14	9606.ENSP00000333657	0.592	Interferon-induced GTP-binding protein Mx2
15	9606.ENSP00000359787	0.570	Interferon-induced protein 44-like
16	9606.ENSP00000263642	0.560	Interferon-induced helicase C domain-containing protein 1
17	9606.ENSP00000368699	0.557	Ubiquitin-like protein ISG15
18	9606.ENSP00000483430	0.553	Interferon alpha-inducible protein 27, mitochondrial
19	9606.ENSP00000359783	0.552	Interferon-induced protein 44
20	9606.ENSP00000359504	0.551	Guanylate-binding protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:1901363	0.970	heterocyclic compound binding
GO:0097159	0.970	organic cyclic compound binding
GO:0003676	0.902	nucleic acid binding
GO:0003723	0.762	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050896	0.997	response to stimulus
GO:0050789	0.987	regulation of biological process
GO:0009605	0.985	response to external stimulus
GO:0009987	0.984	cellular process
GO:0009615	0.981	response to virus
GO:0051607	0.969	defense response to virus
GO:0050792	0.940	regulation of viral process
GO:0048519	0.938	negative regulation of biological process
GO:0050794	0.903	regulation of cellular process
GO:0048525	0.874	negative regulation of viral process
GO:0045069	0.865	regulation of viral genome replication
GO:0045071	0.861	negative regulation of viral genome replication
GO:0042221	0.838	response to chemical
GO:0048518	0.813	positive regulation of biological process
GO:0051716	0.697	cellular response to stimulus
GO:0010033	0.668	response to organic substance
GO:0034097	0.645	response to cytokine
GO:0071310	0.583	cellular response to organic substance
GO:0071345	0.426	cellular response to cytokine stimulus
GO:0048522	0.418	positive regulation of cellular process
GO:0048583	0.416	regulation of response to stimulus
GO:0045087	0.389	innate immune response

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043231	0.879	intracellular membrane-bounded organelle
GO:0012505	0.394	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]