StarFunc result for job id Q5T7B8

User Input

>input (1368 residues)
MASWLYECLCEAELAQYYSHFTALGLQKIDELAKITMKDYSKLGVHDMNDRKRLFQLIKI
IKIMQEEDKAVSIPERHLQTSSLRIKSQELRSGPRRQLNFDSPADNKDRNASNDGFEMCS
LSDFSANEQKSTYLKVLEHMLPDDSQYHTKTGILNATAGDSYVQTEISTSLFSPNYLSAI
LGDCDIPIIQRISHVSGYNYGIPHSCIRQNTSEKQNPWTEMEKIRVCVRKRPLGMREVRR
GEINIITVEDKETLLVHEKKEAVDLTQYILQHVFYFDEVFGEACTNQDVYMKTTHPLIQH
IFNGGNATCFAYGQTGAGKTYTMIGTHENPGLYALAAKDIFRQLEVSQPRKHLFVWISFY
EIYCGQLYDLLNRRKRLFAREDSKHMVQIVGLQELQVDSVELLLEVILKGSKERSTGATG
VNADSSRSHAVIQIQIKDSAKRTFGRISFIDLAGSERAADARDSDRQTKMEGAEINQSLL
ALKECIRALDQEHTHTPFRQSKLTQVLKDSFIGNAKTCMIANISPSHVATEHTLNTLRYA
DRVKELKKGIKCCTSVTSRNRTSGNSSPKRIQSSPGALSEDKCSPKKVKLGFQQSLTVAA
PGSTRGKVHPLTSHPPNIPFTSAPKVSGKRGGSRGSPSQEWVIHASPVKGTVRSGHVAKK
KPEESAPLCSEKNRMGNKTVLGWESRASGPGEGLVRGKLSTKCKKVQTVQPVQKQLVSRV
ELSFGNAHHRAEYSQDSQRGTPARPASEAWTNIPPHQKEREEHLRFYHQQFQQPPLLQQK
LKYQPLKRSLRQYRPPEGQLTNETPPLFHSYSENHDGAQVEELDDSDFSEDSFSHISSQR
ATKQRNTLENSEDSFFLHQTWGQGPEKQVAERQQSLFSSPRTGDKKDLTKSWVDSRDPIN
HRRAALDHSCSPSKGPVDWSRENSTSSGPSPRDSLAEKPYCSQVDFIYRQERGGGSSFDL
RKDASQSEVSGENEGNLPSPEEDGFTISLSHVAVPGSPDQRDTVTTPLREVSADGPIQVT
STVKNGHAVPGEDPRGQLGTHAEYASGLMSPLTMSLLENPDNEGSPPSEQLVQDGATHSL
VAESTGGPVVSHTVPSGDQEAALPVSSATRHLWLSSSPPDNKPGGDLPALSPSPIRQHPA
DKLPSREADLGEACQSRETVLFSHEHMGSEQYDADAEETGLDGSWGFPGKPFTTIHMGVP
HSGPTLTPRTGSSDVADQLWAQERKHPTRLGWQEFGLSTDPIKLPCNSENVTWLKPRPIS
RCLARPSSPLVPSCSPKTAGTLRQPTLEQAQQVVIRAHQEQLDEMAELGFKEETLMSQLA
SNDFEDFVTQLDEIMVLKSKCIQSLRSQLQLYLTCHGPTAAPEGTVPS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T7B8	1.000	1.000	0.000	1368	1.000	1.000	Q5T7B8.pdb.gz	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
2	AFDB:Q9ULI4	0.221	0.164	8.398E-26	1882	0.173	0.126	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
3	PDB:7wrgA	0.209	0.345	9.727E-26	812	0.079	0.133	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
4	AFDB:Q52KG5	0.219	0.164	6.276E-25	1881	0.198	0.144	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
5	AFDB:Q7TNC6	0.213	0.141	4.690E-24	2112	0.175	0.113	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
6	PDB:4h1gA	0.196	0.390	5.145E-24	670	0.076	0.155	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
7	PDB:7wrgB	0.204	0.350	1.611E-23	783	0.078	0.137	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
8	AFDB:Q9EQW7	0.225	0.177	5.088E-17	1749	0.084	0.066	Q9EQW7.pdb.gz	KI13A_MOUSE Kinesin-like protein KIF13A OS=Mus musculus OX=10090 GN=Kif13a PE=1 SV=1
9	AFDB:B0S8G4	0.048	0.043	5.187E-4	1645	0.133	0.111	B0S8G4.pdb.gz
10	AFDB:Q0KHR2	0.066	0.053	7.187E-4	1918	0.140	0.100	Q0KHR2.pdb.gz	Q0KHR2_DROME Forked, isoform F OS=Drosophila melanogaster OX=7227 GN=f PE=4 SV=1
11	AFDB:F1QJ05	0.048	0.045	9.958E-4	1509	0.135	0.123	F1QJ05.pdb.gz
12	AFDB:O97758	0.050	0.043	1.110E-3	1769	0.126	0.098	O97758.pdb.gz	ZO1_CANLF Tight junction protein ZO-1 OS=Canis lupus familiaris OX=9615 GN=TJP1 PE=1 SV=1
13	AFDB:Q70IV5	0.038	0.037	1.110E-3	1561	0.128	0.112	Q70IV5.pdb.gz	SYNEM_MOUSE Synemin OS=Mus musculus OX=10090 GN=Synm PE=1 SV=2
14	PDB:7ls6O	0.053	0.174	7.182E-2	240	0.017	0.096	7ls6O.pdb.gz
15	PDB:3m4uA	0.036	0.103	2.647E-1	285	0.007	0.032	3m4uA.pdb.gz
16	PDB:6e1iA	0.039	0.085	2.647E-1	389	0.017	0.059	6e1iA.pdb.gz
17	PDB:5ikoA	0.035	0.048	2.795E-1	807	0.021	0.036	5ikoA.pdb.gz	Insights into Brain Glycogen Metabolism: THE STRUCTURE OF HUMAN BRAIN GLYCOGEN PHOSPHORYLASE.
18	PDB:7lt2A	0.033	0.082	2.795E-1	387	0.017	0.059	7lt2A.pdb.gz	cGAS-like receptors sense RNA and control 3'2'-cGAMP signalling in Drosophila.
19	PDB:3btsA	0.048	0.126	3.116E-1	384	0.029	0.104	3btsA.pdb.gz	NADP regulates the yeast GAL induction system.
20	PDB:6drvA	0.045	0.056	3.873E-1	1024	0.018	0.024	6drvA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T7B8	0.0	2845	1368	1.000	1.000	KIF24_HUMAN Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2
2	Q6S004	2.36e-115	389	1030	0.140	0.186	KIF6_DICDI Kinesin-related protein 6 OS=Dictyostelium discoideum OX=44689 GN=kif6 PE=2 SV=1
3	Q38FG7	1.04e-111	369	691	0.148	0.294	Q38FG7_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2260 PE=3 SV=1
4	Q386I3	1.52e-111	370	719	0.129	0.246	Q386I3_TRYB2 Kinesin-like protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0790 PE=3 SV=1
5	E9ABZ2	6.85e-108	358	668	0.137	0.280	E9ABZ2_LEIMA Kinesin-like protein OS=Leishmania major OX=5664 GN=LMJF_01_0030 PE=3 SV=1
6	P70096	9.36e-108	359	718	0.135	0.256	KIF2C_CRIGR Kinesin-like protein KIF2C OS=Cricetulus griseus OX=10029 GN=KIF2C PE=1 SV=2
7	Q960Z0	5.13e-107	360	805	0.135	0.229	KI10A_DROME Kinesin-like protein Klp10A OS=Drosophila melanogaster OX=7227 GN=Klp10A PE=1 SV=1
8	Q922S8	5.42e-107	357	721	0.134	0.254	KIF2C_MOUSE Kinesin-like protein KIF2C OS=Mus musculus OX=10090 GN=Kif2c PE=1 SV=1
9	Q99661	9.07e-107	357	725	0.134	0.252	KIF2C_HUMAN Kinesin-like protein KIF2C OS=Homo sapiens OX=9606 GN=KIF2C PE=1 SV=2
10	B9FMJ3	1.81e-106	359	819	0.137	0.230	KN13A_ORYSJ Kinesin-like protein KIN-13A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN13A PE=1 SV=1
11	Q940Y8	3.55e-105	351	684	0.133	0.266	KN13B_ARATH Kinesin-like protein KIN-13B OS=Arabidopsis thaliana OX=3702 GN=KIN13B PE=1 SV=1
12	O00139	4.76e-104	349	706	0.130	0.252	KIF2A_HUMAN Kinesin-like protein KIF2A OS=Homo sapiens OX=9606 GN=KIF2A PE=1 SV=3
13	P28740	1.06e-103	348	705	0.130	0.252	KIF2A_MOUSE Kinesin-like protein KIF2A OS=Mus musculus OX=10090 GN=Kif2a PE=1 SV=2
14	Q9WV63	1.15e-103	348	705	0.130	0.252	KIF2A_RAT Kinesin-like protein KIF2A OS=Rattus norvegicus OX=10116 GN=Kif2a PE=1 SV=2
15	Q940B8	1.34e-103	350	794	0.158	0.272	KN13A_ARATH Kinesin-like protein KIN-13A OS=Arabidopsis thaliana OX=3702 GN=KIN13A PE=1 SV=1
16	Q9W1U4	4.74e-99	332	626	0.129	0.281	KI59C_DROME Kinesin-like protein Klp59C OS=Drosophila melanogaster OX=7227 GN=Klp59C PE=3 SV=1
17	Q8IHF4	4.27e-98	333	729	0.132	0.248	Q8IHF4_DROME AT07729p OS=Drosophila melanogaster OX=7227 GN=Klp59D PE=2 SV=1
18	Q9W1U1	5.05e-98	333	729	0.132	0.248	Q9W1U1_DROME FI21273p1 OS=Drosophila melanogaster OX=7227 GN=Klp59D PE=2 SV=2
19	G5ED75	5.78e-97	328	689	0.121	0.241	G5ED75_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-7 PE=1 SV=1
20	Q9XU12	2.40e-96	328	747	0.121	0.222	Q9XU12_CAEEL Kinesin-like protein OS=Caenorhabditis elegans OX=6239 GN=klp-7 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	3.8e-95	330.2	Kinesin motor domain
2	PF16796 Microtub_bd	4.6e-13	60.8	Microtubule binding
3	PF00536 SAM_1	0.043	25.6	SAM domain (Sterile alpha motif)
4	PF07647 SAM_2	81	14.8	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000368464

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000370803	0.972	Centriolar coiled-coil protein of 110 kDa
2	9606.ENSP00000342510	0.916	Centrosomal protein of 97 kDa
3	9606.ENSP00000413592	0.760	Rieske domain-containing protein
4	9606.ENSP00000297661	0.732	Ubiquitin-associated protein 1
5	9606.ENSP00000355966	0.731	Serine/threonine-protein kinase Nek2
6	9606.ENSP00000277458	0.714	Ankyrin repeat and SOCS box protein 6
7	9606.ENSP00000370607	0.705	trans-2,3-enoyl-CoA reductase like
8	9606.ENSP00000328287	0.692	E3 ubiquitin-protein ligase RNF123
9	9606.ENSP00000323584	0.682	Teashirt homolog 1
10	9606.ENSP00000297540	0.677	Phosphorylated adapter RNA export protein
11	9606.ENSP00000240055	0.674	Nuclear transcription factor Y subunit beta
12	9606.ENSP00000054650	0.662	THAP domain-containing protein 3
13	9606.ENSP00000427114	0.657	FYN-binding protein 1
14	9606.ENSP00000448012	0.657	Centrosomal protein of 290 kDa
15	9606.ENSP00000346359	0.644	Protein TALPID3
16	9606.ENSP00000364749	0.643	REM2- and Rab-like small GTPase 1
17	9606.ENSP00000358753	0.626	Protein pitchfork
18	9606.ENSP00000011898	0.614	Tetraspanin-9
19	9606.ENSP00000237937	0.611	AN1-type zinc finger protein 5
20	9606.ENSP00000274432	0.597	Spermatogenesis-associated protein 9

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0003777	1.000	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0016043	0.988	cellular component organization
GO:0050794	0.986	regulation of cellular process
GO:0006996	0.975	organelle organization
GO:0033043	0.973	regulation of organelle organization
GO:0007010	0.959	cytoskeleton organization
GO:0007017	0.948	microtubule-based process
GO:0044782	0.940	cilium organization
GO:0030031	0.924	cell projection assembly
GO:1902115	0.918	regulation of organelle assembly
GO:0000226	0.907	microtubule cytoskeleton organization
GO:0060271	0.901	cilium assembly
GO:0010639	0.868	negative regulation of organelle organization
GO:0120032	0.819	regulation of plasma membrane bounded cell projection assembly
GO:0097435	0.787	supramolecular fiber organization
GO:1902017	0.720	regulation of cilium assembly
GO:0031345	0.707	negative regulation of cell projection organization
GO:0031109	0.643	microtubule polymerization or depolymerization
GO:0022411	0.630	cellular component disassembly
GO:1902116	0.609	negative regulation of organelle assembly
GO:0120033	0.596	negative regulation of plasma membrane bounded cell projection assembly
GO:0007019	0.583	microtubule depolymerization
GO:0007049	0.300	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015630	1.000	microtubule cytoskeleton
GO:0005829	0.995	cytosol
GO:0005815	0.989	microtubule organizing center
GO:0032991	0.988	protein-containing complex
GO:0043227	0.979	membrane-bounded organelle
GO:0005814	0.977	centriole
GO:0005813	0.969	centrosome
GO:0043231	0.905	intracellular membrane-bounded organelle
GO:0005634	0.787	nucleus
GO:0005929	0.426	cilium

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]