StarFunc result for job id Q5T7M4

User Input

>input (302 residues)
MRRWAWAAVVVLLGPQLVLLGGVGARREAQRTQQPGQRADPPNATASASSREGLPEAPKP
SQASGPEFSDAHMTWLNFVRRPDDGALRKRCGSRDKKPRDLFGPPGPPGAEVTAETLLHE
FQELLKEATERRFSGLLDPLLPQGAGLRLVGEAFHCRLQGPRRVDKRTLVELHGFQAPAA
QGAFLRGSGLSLASGRFTAPVSGIFQFSASLHVDHSELQGKARLRARDVVCVLICIESLC
QRHTCLEAVSGLESNSRVFTLQVQGLLQLQAGQYASVFVDNGSGAVLTIQAGSSFSGLLL
GT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R2Z0	0.550	0.540	2.910E-39	308	0.715	0.701	Q8R2Z0.pdb.gz	ADIPL_MOUSE Adipolin OS=Mus musculus OX=10090 GN=C1qtnf12 PE=1 SV=2
2	AFDB:Q6PGN1	0.502	0.447	4.432E-27	340	0.424	0.376	Q6PGN1.pdb.gz	ERFE_MOUSE Erythroferrone OS=Mus musculus OX=10090 GN=Erfe PE=1 SV=1
3	AFDB:O14788	0.352	0.338	3.559E-10	317	0.139	0.132	O14788.pdb.gz	TNF11_HUMAN Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1
4	AFDB:Q80WE6	0.351	0.345	9.287E-9	308	0.136	0.133	Q80WE6.pdb.gz	Q80WE6_RAT TNF superfamily member 9 OS=Rattus norvegicus OX=10116 GN=Tnfsf9 PE=2 SV=1
5	AFDB:Q9BXJ1	0.361	0.386	3.615E-8	281	0.166	0.178	Q9BXJ1.pdb.gz	C1QT1_HUMAN Complement C1q tumor necrosis factor-related protein 1 OS=Homo sapiens OX=9606 GN=C1QTNF1 PE=1 SV=1
6	AFDB:Q9QXP7	0.373	0.398	3.615E-8	281	0.159	0.171	Q9QXP7.pdb.gz	C1QT1_MOUSE Complement C1q tumor necrosis factor-related protein 1 OS=Mus musculus OX=10090 GN=C1qtnf1 PE=2 SV=1
7	AFDB:A2RQR3	0.294	0.147	2.702E-7	655	0.162	0.075	A2RQR3.pdb.gz	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1
8	AFDB:Q6I1X8	0.343	0.269	3.181E-7	400	0.149	0.113	Q6I1X8.pdb.gz	Q6I1X8_BACAN BclA protein (Fragment) OS=Bacillus anthracis OX=1392 GN=bclA PE=1 SV=1
9	AFDB:Q4ZJM7	0.333	0.217	3.358E-7	482	0.179	0.112	Q4ZJM7.pdb.gz	OTOL1_MOUSE Otolin-1 OS=Mus musculus OX=10090 GN=Otol1 PE=1 SV=2
10	AFDB:P25067	0.328	0.154	3.953E-7	703	0.232	0.100	P25067.pdb.gz	CO8A2_HUMAN Collagen alpha-2(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=2
11	PDB:5h4bA	0.338	0.692	3.815E-6	136	0.086	0.191	5h4bA.pdb.gz
12	PDB:5kc6B	0.345	0.670	2.852E-5	144	0.086	0.181	5kc6B.pdb.gz
13	PDB:7e57B	0.233	0.511	1.353E-3	123	0.043	0.106	7e57B.pdb.gz	Atypical TNF-TNFR superfamily binding interface in the GITR-GITRL complex for T cell activation.
14	PDB:6oj0A	0.244	0.355	2.091E-3	178	0.033	0.056	6oj0A.pdb.gz
15	PDB:6ds5A	0.259	0.415	1.563E-2	160	0.043	0.081	6ds5A.pdb.gz
16	PDB:3i26D	0.142	0.123	1.742E-2	369	0.046	0.038	3i26D.pdb.gz	Structural basis for ligand and substrate recognition by torovirus hemagglutinin esterases
17	PDB:5eiyB	0.228	0.117	1.742E-2	658	0.070	0.032	5eiyB.pdb.gz	Observing cellulose biosynthesis and membrane translocation in crystallo.
18	PDB:7drtB	0.220	0.164	1.942E-2	496	0.066	0.040	7drtB.pdb.gz	Cryo-EM structure of human Wntless in complex with Wnt3a.
19	PDB:4tlgA	0.216	0.170	3.168E-2	396	0.066	0.051	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
20	PDB:7jluA	0.080	0.045	3.168E-2	726	0.073	0.030	7jluA.pdb.gz	Structure of the activated ROQ1 resistosome directly recognizing the pathogen effector XopQ.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8R2Z0	1.51e-132	380	308	0.689	0.675	ADIPL_MOUSE Adipolin OS=Mus musculus OX=10090 GN=C1qtnf12 PE=1 SV=2
2	Q6PGN1	1.29e-47	164	340	0.381	0.338	ERFE_MOUSE Erythroferrone OS=Mus musculus OX=10090 GN=Erfe PE=1 SV=1
3	P25318	0.18	35.8	699	0.129	0.056	CO8A2_MOUSE Collagen alpha-2(VIII) chain OS=Mus musculus OX=10090 GN=Col8a2 PE=2 SV=2
4	P25067	0.21	35.8	703	0.106	0.046	CO8A2_HUMAN Collagen alpha-2(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=2
5	Q4VAQ0	0.22	35.4	427	0.106	0.075	Q4VAQ0_HUMAN COL8A2 protein OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=1
6	Q9ES30	0.24	35.0	246	0.099	0.122	C1QT3_MOUSE Complement C1q tumor necrosis factor-related protein 3 OS=Mus musculus OX=10090 GN=C1qtnf3 PE=2 SV=1
7	C8V1D1	1.2	33.1	412	0.076	0.056	BIOF_EMENI 8-amino-7-oxononanoate synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=bioF PE=2 SV=1
8	Q9BXJ4	1.5	32.3	246	0.099	0.122	C1QT3_HUMAN Complement C1q tumor necrosis factor-related protein 3 OS=Homo sapiens OX=9606 GN=C1QTNF3 PE=1 SV=1
9	Q9GUP2	1.5	33.1	4177	0.103	0.007	Q9GUP2_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=2
10	U4PBY0	1.6	33.1	4185	0.103	0.007	U4PBY0_CAEEL HECT-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=eel-1 PE=1 SV=1
11	B3TPQ6	4.8	31.2	550	0.089	0.049	BCUSY_MAGGA Beta-cubebene synthase OS=Magnolia grandiflora OX=3406 PE=1 SV=1
12	P43562	5.4	31.2	540	0.053	0.030	YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YFL040W PE=1 SV=1
13	A0A3B3IPE9	5.9	31.2	1119	0.036	0.010	A0A3B3IPE9_HUMAN Rho/Rac guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=2
14	A0A087WZG4	6.0	31.2	1173	0.036	0.009	A0A087WZG4_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=3
15	M0QZS0	6.5	30.8	812	0.036	0.014	M0QZS0_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=1
16	A0A590UK10	7.1	30.8	1089	0.036	0.010	A0A590UK10_HUMAN Rho guanine nucleotide exchange factor 18 (Fragment) OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=4 SV=1
17	Q9VZV2	8.0	30.8	1013	0.070	0.021	Q9VZV2_DROME Chitinase 7 OS=Drosophila melanogaster OX=7227 GN=Cht7 PE=2 SV=3
18	Q9I3M6	8.5	30.4	366	0.079	0.066	Q9I3M6_PSEAE S58 family peptidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=PA1486 PE=3 SV=1
19	Q6ZSZ5	9.1	30.4	1361	0.036	0.008	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
20	Q72CB5	9.5	30.4	540	0.063	0.035	Q72CB5_DESVH Rhodanese-like domain protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_1368 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00386 C1q	1.4	20.6	C1q domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000329137

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371503	0.700	Complement C1q and tumor necrosis factor-related protein 9A
2	9606.ENSP00000363939	0.679	Calcineurin subunit B type 2
3	9606.ENSP00000396747	0.642	Ankyrin repeat domain-containing protein 60
4	9606.ENSP00000330199	0.622	Sodium-dependent neutral amino acid transporter SLC6A17
5	9606.ENSP00000351682	0.611	Carnosine dipeptidase 1
6	9606.ENSP00000298943	0.609	Complement C1q-like protein 3
7	9606.ENSP00000371497	0.602	Complement C1q tumor necrosis factor-related protein 3
8	9606.ENSP00000298892	0.582	Caprin-2
9	9606.ENSP00000340864	0.571	Complement C1q tumor necrosis factor-related protein 1
10	9606.ENSP00000248089	0.560	Host cell factor C1 regulator 1
11	9606.ENSP00000307911	0.540	Carbohydrate sulfotransferase 2
12	9606.ENSP00000335285	0.534	Complement C1q-like protein 4
13	9606.ENSP00000295297	0.522	Complement C1q tumor necrosis factor-related protein 7
14	9606.ENSP00000361499	0.504	Protein YIPF3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005179	1.000	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.990	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0019222	0.975	regulation of metabolic process
GO:0048522	0.971	positive regulation of cellular process
GO:0071702	0.960	organic substance transport
GO:0080090	0.948	regulation of primary metabolic process
GO:0031323	0.932	regulation of cellular metabolic process
GO:0032879	0.885	regulation of localization
GO:0008152	0.846	metabolic process
GO:0051050	0.827	positive regulation of transport
GO:0010646	0.814	regulation of cell communication
GO:0071704	0.812	organic substance metabolic process
GO:0044238	0.770	primary metabolic process
GO:0023052	0.759	signaling
GO:0050896	0.736	response to stimulus
GO:0048583	0.735	regulation of response to stimulus
GO:0023051	0.731	regulation of signaling
GO:0023056	0.692	positive regulation of signaling
GO:0010647	0.692	positive regulation of cell communication
GO:0048523	0.691	negative regulation of cellular process
GO:0009889	0.683	regulation of biosynthetic process
GO:0009966	0.617	regulation of signal transduction
GO:0009967	0.495	positive regulation of signal transduction
GO:0065008	0.415	regulation of biological quality
GO:0060255	0.401	regulation of macromolecule metabolic process
GO:0031324	0.401	negative regulation of cellular metabolic process
GO:1903532	0.396	positive regulation of secretion by cell
GO:1902533	0.391	positive regulation of intracellular signal transduction
GO:0010817	0.386	regulation of hormone levels
GO:0051223	0.382	regulation of protein transport
GO:0034762	0.364	regulation of transmembrane transport
GO:0051649	0.362	establishment of localization in cell
GO:0046883	0.351	regulation of hormone secretion
GO:0062012	0.347	regulation of small molecule metabolic process
GO:0031326	0.342	regulation of cellular biosynthetic process
GO:0034764	0.337	positive regulation of transmembrane transport
GO:1901576	0.320	organic substance biosynthetic process
GO:0046887	0.317	positive regulation of hormone secretion
GO:0007154	0.308	cell communication
GO:0051716	0.301	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0005615	0.993	extracellular space
GO:0005622	0.937	intracellular anatomical structure
GO:0043227	0.919	membrane-bounded organelle
GO:0043231	0.841	intracellular membrane-bounded organelle
GO:0005737	0.741	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]