StarFunc result for job id Q5T7N3

User Input

>input (995 residues)
MEKTDAKDQSSQGDEEKDPPKSHPYSVETPYGFHLDLDFLKYVDDIEKGNTIKRIPIHRR
AKQAKFSTLPRNFSLPDSGARPPAAPPLQNWSPVVPREASLGTQEQNQSPPLGNAPQAST
SRSEVSYHRKALLAEATRQLEAAEPEDAELTFGSGRPQLLRASSMPATLLHSRASEEPGL
SLGPPAPPALPPLQGEGSVCDGTFEPAEGLAGFHSSSPRASTRIPELVQEGAEPPEGVVK
VPNHLPLPGPPFSFQNVLVVLEDKEDEHNAREAEVLFTPGSPTPSPPPLPSPIPENELLL
EEIELNISEIPPPPPVEVDMRSIGIRVTEESLGLARVDPGSISSLKQQVSALEGELSGRT
EELAQVRTALQQQEEEIKAREQRIRELEFTVAQLEGQFHQENAKDTQGQTDVMVNTDPVH
GLLTRESCDKGIEVNLLGSMESESWGHRGEENGLLWGPDGHKQGNQSPAERVLLPQLSLP
QGPEQVLTSSVHSFLSTELRIEEAGTEQEGGPQGGTRGAGGFLWGSDRKTPPAGREETSS
NLPGKEHPGRPPSSPTDATIGQYVKKIQELLQEQWNCLEHGYPELASAIKQPASKLSSIQ
SQLLSSLNLLLSAYSAQAHPPKEPPASSSSPPVEISPSTSLKSIMKKKDYGFRAGGNGTK
KNLQFVGVNGGYETTSSEETSGEDSTPEDLSDSEAEKKCDGPDHKHVKDAHLTCEAGQGI
PEGTCHAAQESGPGEEVPHSKAERYKPSEEFLNACRALSQHLPETGTTTDQLLRQSLNTI
SQEWFRVSSRKSSSPAVVASYLHEVQPHSPHFLKLLVNLADHNGNTALHYSVSHSNFSIV
KLLLETGVCNVDHQNKAGYTAVMITPLASAETNEDMAVVWKLLREGNVNIQATQGGQTAL
MLGVSHDREDMVQALLSCQADVNLQDHDGSSALMVACHHGNVDLVRLLLAHPACDSSLTD
KAGRTALSIALKSPTHMEIAGLLRAHAEQGRSLGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T7N3	1.000	1.000	0.000	995	1.000	1.000	Q5T7N3.pdb.gz	KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1
2	AFDB:X1WE18	0.252	0.231	1.799E-26	1085	0.263	0.241	X1WE18.pdb.gz	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
3	AFDB:A2ABF8	0.164	0.134	4.186E-9	1233	0.146	0.118	A2ABF8.pdb.gz	A2ABF8_HUMAN Euchromatic histone lysine methyltransferase 2 OS=Homo sapiens OX=9606 GN=EHMT2 PE=1 SV=1
4	PDB:2dvwA	0.165	0.666	2.444E-8	229	0.054	0.236	2dvwA.pdb.gz
5	PDB:4oauC	0.149	0.210	8.282E-8	692	0.057	0.082	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
6	PDB:8cs9A	0.163	0.201	9.534E-8	796	0.048	0.060	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
7	PDB:1wg0A	0.164	0.585	1.674E-7	243	0.047	0.193	1wg0A.pdb.gz
8	PDB:6jd6B	0.156	0.736	2.326E-7	192	0.045	0.234	6jd6B.pdb.gz
9	PDB:5vkqA	0.145	0.101	9.964E-7	1499	0.053	0.035	5vkqA.pdb.gz
10	PDB:6v9hC	0.132	0.395	5.151E-6	270	0.049	0.181	6v9hC.pdb.gz
11	PDB:1bu9A	0.145	0.794	5.929E-6	168	0.041	0.244	1bu9A.pdb.gz
12	PDB:1bd8A	0.141	0.823	7.154E-6	156	0.038	0.244	1bd8A.pdb.gz
13	PDB:6aunA	0.151	0.234	4.462E-5	618	0.040	0.065	6aunA.pdb.gz
14	AFDB:Q6W2J9	0.107	0.065	6.937E-5	1755	0.156	0.088	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
15	AFDB:Q13625	0.115	0.102	1.615E-4	1128	0.144	0.127	Q13625.pdb.gz	ASPP2_HUMAN Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2 PE=1 SV=2
16	AFDB:P33244	0.055	0.054	1.859E-4	1027	0.136	0.131	P33244.pdb.gz	FTZF1_DROME Nuclear hormone receptor FTZ-F1 OS=Drosophila melanogaster OX=7227 GN=ftz-f1 PE=1 SV=2
17	AFDB:Q8CGN4	0.116	0.071	3.264E-4	1759	0.167	0.094	Q8CGN4.pdb.gz	BCOR_MOUSE BCL-6 corepressor OS=Mus musculus OX=10090 GN=Bcor PE=1 SV=2
18	AFDB:Q8IQT4	0.128	0.066	6.600E-4	2133	0.170	0.079	Q8IQT4.pdb.gz	Q8IQT4_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Nirvana PE=1 SV=1
19	AFDB:F1RCL8	0.110	0.063	8.747E-4	1796	0.177	0.098	F1RCL8.pdb.gz	F1RCL8_DANRE BCL-6 corepressor isoform X1 OS=Danio rerio OX=7955 GN=bcor PE=1 SV=1
20	AFDB:P39083	0.053	0.053	1.273E-3	1007	0.134	0.132	P39083.pdb.gz	RGA1_YEAST Rho-type GTPase-activating protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RGA1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T7N3	0.0	2021	995	1.000	1.000	KANK4_HUMAN KN motif and ankyrin repeat domain-containing protein 4 OS=Homo sapiens OX=9606 GN=KANK4 PE=1 SV=1
2	Q14678	7.71e-90	316	1352	0.215	0.158	KANK1_HUMAN KN motif and ankyrin repeat domain-containing protein 1 OS=Homo sapiens OX=9606 GN=KANK1 PE=1 SV=3
3	Q63ZY3	1.85e-79	279	851	0.153	0.179	KANK2_HUMAN KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1
4	D3ZD05	1.71e-76	270	847	0.150	0.176	KANK2_RAT KN motif and ankyrin repeat domain-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Kank2 PE=1 SV=2
5	Q8BX02	1.20e-74	265	843	0.143	0.168	KANK2_MOUSE KN motif and ankyrin repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Kank2 PE=1 SV=1
6	X1WE18	1.83e-72	263	1085	0.128	0.117	KANK2_DANRE KN motif and ankyrin repeat domain-containing protein 2 OS=Danio rerio OX=7955 GN=kank2 PE=3 SV=1
7	A0A0B4JD77	2.73e-54	197	446	0.103	0.229	A0A0B4JD77_DROME Kank, isoform J OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
8	A1Z9W7	2.99e-52	201	1042	0.103	0.098	A1Z9W7_DROME Kank, isoform B OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
9	A0A0B4KF63	3.07e-52	201	1039	0.103	0.098	A0A0B4KF63_DROME Kank, isoform I OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
10	A0A0B4JD54	3.95e-52	201	1063	0.103	0.096	A0A0B4JD54_DROME Kank, isoform F OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
11	A0A0B4JCT6	5.88e-52	201	1294	0.103	0.079	A0A0B4JCT6_DROME Kank, isoform G OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
12	Q7KMM8	5.98e-52	201	1224	0.103	0.083	Q7KMM8_DROME BcDNA.GH03482 OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
13	A8DYE0	7.01e-52	201	1339	0.103	0.076	A8DYE0_DROME Kank, isoform D OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
14	A1Z9W5	8.51e-52	201	1301	0.103	0.078	A1Z9W5_DROME Kank, isoform C OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
15	Q5BIA1	1.01e-51	200	1301	0.103	0.078	Q5BIA1_DROME RE07880p OS=Drosophila melanogaster OX=7227 GN=Kank PE=2 SV=1
16	G5EDN8	1.75e-51	199	1040	0.117	0.112	G5EDN8_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=vab-19 PE=1 SV=1
17	E1JH70	4.27e-23	108	934	0.053	0.057	E1JH70_DROME Kank, isoform E OS=Drosophila melanogaster OX=7227 GN=Kank PE=4 SV=1
18	X2JCM1	4.12e-12	73.6	11634	0.058	0.005	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
19	M9MRX4	5.85e-12	72.8	13559	0.058	0.004	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	E7FFI8	4.14e-11	69.3	619	0.056	0.090	E7FFI8_DANRE B-cell lymphoma 3 protein homolog OS=Danio rerio OX=7955 GN=bcl3 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	7.1	18.2	Afadin- and alpha -actinin-Binding
2	PF00023 Ank	4.1e-12	57.2	Ankyrin repeat
3	PF12796 Ank_2	2.1e-19	81.2	Ankyrin repeats (3 copies)
4	PF13606 Ank_3	8.5e-13	58.1	Ankyrin repeat
5	PF13637 Ank_4	4.6e-15	67.0	Ankyrin repeats (many copies)
6	PF13857 Ank_5	4.3e-13	60.5	Ankyrin repeats (many copies)
7	PF05667 CCDC22	2.4e+02	11.9	Coiled-coil domain-containing protein 22
8	PF10473 CENP-F_leu_zip	1.8e+02	13.6	Leucine-rich repeats of kinetochore protein Cenp-F/LEK1
9	PF13094 CENP-Q	44	15.7	CENP-Q, a CENPA-CAD centromere complex subunit
10	PF17045 CEP63	17	16.7	Centrosomal protein of 63 kDa
11	PF19220 Crescentin	41	14.7	Crescentin protein
12	PF08826 DMPK_coil	5.9e+02	12.0	DMPK coiled coil domain like
13	PF16888 DUF5082	14	17.4	Domain of unknown function (DUF5082)
14	PF06818 Fez1	0.26	23.2	Fez1
15	PF12075 KN_motif	3.8e-19	79.5	KN motif
16	PF03285 Paralemmin	3.5e+02	12.1	Paralemmin
17	PF12072 RNase_Y_N	5.6e+02	11.3	RNase Y N-terminal region
18	PF07160 SKA1	5e+02	11.9	Spindle and kinetochore-associated protein 1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000360195

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419901	0.815	LINE1 type transposase domain containing 1
2	9606.ENSP00000299088	0.770	Uncharacterized protein C14orf93
3	9606.ENSP00000360200	0.744	InaD-like protein
4	9606.ENSP00000283882	0.733	Craniofacial development protein 1
5	9606.ENSP00000269321	0.683	Rho GDP-dissociation inhibitor 1
6	9606.ENSP00000253401	0.676	Rho guanine nucleotide exchange factor 9
7	9606.ENSP00000315118	0.658	Atypical kinase COQ8B, mitochondrial
8	9606.ENSP00000321691	0.657	Glutamine amidotransferase-like class 1 domain-containing protein 1
9	9606.ENSP00000300591	0.650	Lipoxygenase homology domain-containing protein 1
10	9606.ENSP00000418944	0.649	Retrotransposon-derived protein PEG10
11	9606.ENSP00000470262	0.631	Trafficking protein particle complex subunit 5
12	9606.ENSP00000324741	0.629	Uncharacterized protein C7orf43
13	9606.ENSP00000392495	0.629	Trafficking protein particle complex subunit 2
14	9606.ENSP00000302783	0.625	Trafficking protein particle complex subunit 1
15	9606.ENSP00000480332	0.616	Trafficking protein particle complex subunit 3
16	9606.ENSP00000369399	0.566	Sodium bicarbonate transporter-like protein 11
17	9606.ENSP00000258341	0.563	Laminin subunit gamma-1
18	9606.ENSP00000413001	0.531	Cytosolic carboxypeptidase 4
19	9606.ENSP00000380861	0.528	Zinc finger and BTB domain-containing protein 44
20	9606.ENSP00000356790	0.526	Sodium/potassium-transporting ATPase subunit beta-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.977	regulation of biological process
GO:0050794	0.974	regulation of cellular process
GO:0009987	0.970	cellular process
GO:0032501	0.519	multicellular organismal process
GO:0048583	0.511	regulation of response to stimulus
GO:0048519	0.336	negative regulation of biological process
GO:0048523	0.327	negative regulation of cellular process
GO:0032502	0.306	developmental process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005829	0.990	cytosol
GO:0005856	0.986	cytoskeleton
GO:0015630	0.865	microtubule cytoskeleton
GO:0043231	0.801	intracellular membrane-bounded organelle
GO:0071944	0.640	cell periphery
GO:0016020	0.517	membrane
GO:0005886	0.410	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]