StarFunc result for job id Q5T7W0

User Input

>input (954 residues)
MNQPGGAAAPQADGASAAGRKSTASRERLKRSQKSTKVEGPEPVPAEASLSAEQGTMTEV
KVKTELPDDYIQEVIWQGEAKEEKKAVSKDGTSDVPAEICVVIGGVRNQQTLDGKAPEGS
PHGGSVRSRYSGTWIFDQALRYASGSYECGICGKKYKYYNCFQTHVRAHRDTEATSGEGA
SQSNNFRYTCDICGKKYKYYSCFQEHRDLHAVDVFSVEGAPENRADPFDQGVVATDEVKE
EPPEPFQKIGPKTGNYTCEFCGKQYKYYTPYQEHVALHAPISTAPGWEPPDDPDTGSECS
HPEVSPSPRFVAAKTQTNQSGKKAPASVVRCATLLHRTPPATQTQTFRTPNSGSPASKAT
AAESAFSRRVEGKAQNHFEETNSSSQNSSEPYTCGACGIQFQFYNNLLEHMQSHAADNEN
NIASNQSRSPPAVVEEKWKPQAQRNSANNTTTSGLTPNSMIPEKERQNIAERLLRVMCAD
LGALSVVSGKEFLKLAQTLVDSGARYGAFSVTEILGNFNTLALKHLPRMYNQVKVKVTCA
LGSNACLGIGVTCHSQSVGPDSCYILTAYQAEGNHIKSYVLGVKGADIRDSGDLVHHWVQ
NVLSEFVMSEIRTVYVTDCRVSTSAFSKAGMCLRCSACALNSVVQSVLSKRTLQARSMHE
VIELLNVCEDLAGSTGLAKETFGSLEETSPPPCWNSVTDSLLLVHERYEQICEFYSRAKK
MNLIQSLNKHLLSNLAAILTPVKQAVIELSNESQPTLQLVLPTYVRLEKLFTAKANDAGT
VSKLCHLFLEALKENFKVHPAHKVAMILDPQQKLRPVPPYQHEEIIGKVCELINEVKESW
AEEADFEPAAKKPRSAAVENPAAQEDDRLGKNEVYDYLQEPLFQATPDLFQYWSCVTQKH
TKLAKLAFWLLAVPAVGARSGCVNMCEQALLIKRRRLLSPEDMNKLMFLKSNML

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q5T7W0	1.000	1.000	0.000	954	1.000	1.000	Q5T7W0.pdb.gz	ZN618_HUMAN Zinc finger protein 618 OS=Homo sapiens OX=9606 GN=ZNF618 PE=1 SV=1
2	AFDB:Q54TL0	0.061	0.050	3.801E-3	1255	0.095	0.073	Q54TL0.pdb.gz	KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum OX=44689 GN=kif7 PE=2 SV=1
3	AFDB:B8PWL7	0.049	0.047	9.631E-3	994	0.131	0.126	B8PWL7.pdb.gz	B8PWL7_DANRE Disrupted in schizophrenia 1 OS=Danio rerio OX=7955 GN=disc1 PE=2 SV=1
4	AFDB:Q9Y4F4	0.090	0.061	1.107E-2	1720	0.116	0.065	Q9Y4F4.pdb.gz	TGRM1_HUMAN TOG array regulator of axonemal microtubules protein 1 OS=Homo sapiens OX=9606 GN=TOGARAM1 PE=1 SV=4
5	PDB:7ou2B	0.071	0.094	1.362E-2	650	0.045	0.066	7ou2B.pdb.gz	Cryogenic electron microscopy structures reveal how ATP and DNA binding in MutS coordinates sequential steps of DNA mismatch repair.
6	AFDB:F4IKX0	0.080	0.071	1.934E-2	1108	0.139	0.120	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
7	AFDB:G5E870	0.078	0.045	3.540E-2	2025	0.116	0.055	G5E870.pdb.gz	TRIPC_MOUSE E3 ubiquitin-protein ligase TRIP12 OS=Mus musculus OX=10090 GN=Trip12 PE=1 SV=1
8	AFDB:Q54DW4	0.082	0.064	3.884E-2	1350	0.124	0.087	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
9	AFDB:Q14669	0.062	0.045	4.069E-2	1992	0.115	0.055	Q14669.pdb.gz	TRIPC_HUMAN E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1
10	PDB:5hg1A	0.121	0.130	4.353E-2	867	0.043	0.047	5hg1A.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.
11	AFDB:P25822	0.078	0.056	4.466E-2	1533	0.118	0.074	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
12	PDB:3idhA	0.083	0.145	5.004E-2	453	0.048	0.102	3idhA.pdb.gz	The active conformation of human glucokinase is not altered by allosteric activators
13	AFDB:Q86CZ2	0.069	0.057	7.447E-2	1213	0.099	0.077	Q86CZ2.pdb.gz	DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum OX=44689 GN=dhkK PE=1 SV=1
14	PDB:1ng9A	0.076	0.086	7.965E-2	794	0.050	0.060	1ng9A.pdb.gz	The alternating ATPase domains of MutS control DNA mismatch repair
15	PDB:7pntV	0.070	0.126	1.527E-1	365	0.041	0.107	7pntV.pdb.gz	Mechanism of mitoribosomal small subunit biogenesis and preinitiation.
16	PDB:3j9zSK	0.069	0.385	1.927E-1	128	0.013	0.094	3j9zSK.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
17	PDB:6p7bA	0.067	0.284	1.927E-1	149	0.017	0.107	6p7bA.pdb.gz	Structural insights into the promiscuous DNA binding and broad substrate selectivity of fowlpox virus resolvase.
18	PDB:2nztB	0.112	0.121	2.018E-1	867	0.039	0.043	2nztB.pdb.gz	The catalytic inactivation of the N-half of human hexokinase 2 and structural and biochemical characterization of its mitochondrial conformation.
19	PDB:1qhaA	0.110	0.114	2.114E-1	903	0.048	0.051	1qhaA.pdb.gz	Binding of non-catalytic ATP to human hexokinase I highlights the structural components for enzyme-membrane association control.
20	PDB:5hfuB	0.125	0.131	2.114E-1	897	0.043	0.046	5hfuB.pdb.gz	Discovery of a Novel 2,6-Disubstituted Glucosamine Series of Potent and Selective Hexokinase 2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5T7W0	0.0	1995	954	1.000	1.000	ZN618_HUMAN Zinc finger protein 618 OS=Homo sapiens OX=9606 GN=ZNF618 PE=1 SV=1
2	P59923	1.58e-08	61.2	1031	0.067	0.062	ZN445_HUMAN Zinc finger protein 445 OS=Homo sapiens OX=9606 GN=ZNF445 PE=1 SV=1
3	Q25442	9.84e-08	58.2	612	0.070	0.109	Q25442_MUSDO Transposase OS=Musca domestica OX=7370 PE=1 SV=1
4	Q8K3J5	7.11e-07	55.5	619	0.051	0.079	ZN131_MOUSE Zinc finger protein 131 OS=Mus musculus OX=10090 GN=Znf131 PE=1 SV=1
5	A8K8Y5	1.93e-06	54.3	707	0.068	0.092	A8K8Y5_HUMAN cDNA FLJ78762, highly similar to Homo sapiens zinc finger protein 224, mRNA OS=Homo sapiens OX=9606 PE=1 SV=1
6	Q9UJW7	2.57e-06	53.9	825	0.068	0.079	ZN229_HUMAN Zinc finger protein 229 OS=Homo sapiens OX=9606 GN=ZNF229 PE=1 SV=4
7	P52739	4.50e-06	53.1	623	0.051	0.079	ZN131_HUMAN Zinc finger protein 131 OS=Homo sapiens OX=9606 GN=ZNF131 PE=1 SV=2
8	Q9BX82	4.83e-06	52.8	626	0.071	0.109	ZN471_HUMAN Zinc finger protein 471 OS=Homo sapiens OX=9606 GN=ZNF471 PE=2 SV=1
9	Q9NZL3	5.60e-06	52.8	707	0.064	0.086	ZN224_HUMAN Zinc finger protein 224 OS=Homo sapiens OX=9606 GN=ZNF224 PE=1 SV=3
10	Q3V362	1.38e-05	51.2	622	0.066	0.101	Q3V362_MOUSE Zinc finger protein 251 (Fragment) OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
11	Q3USU9	1.75e-05	51.2	632	0.066	0.100	Q3USU9_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
12	Q6PCX8	1.86e-05	50.8	632	0.066	0.100	Q6PCX8_MOUSE Zinc finger protein 251 OS=Mus musculus OX=10090 GN=Zfp251 PE=2 SV=1
13	O88553	2.08e-05	50.8	601	0.071	0.113	ZFP37_RAT Zinc finger protein 37 OS=Rattus norvegicus OX=10116 GN=Zfp37 PE=1 SV=1
14	A0A0C4DGQ3	3.48e-05	49.7	455	0.052	0.110	A0A0C4DGQ3_HUMAN Zinc finger protein 556 OS=Homo sapiens OX=9606 GN=ZNF556 PE=1 SV=1
15	P17141	3.87e-05	50.1	594	0.072	0.116	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
16	Q61967	4.13e-05	49.7	636	0.065	0.097	ZFP90_MOUSE Zinc finger protein 90 OS=Mus musculus OX=10090 GN=Zfp90 PE=1 SV=1
17	A0A0U1RQ46	4.16e-05	49.7	609	0.071	0.112	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
18	Q5EBL2	5.05e-05	49.7	1059	0.044	0.040	ZN628_HUMAN Zinc finger protein 628 OS=Homo sapiens OX=9606 GN=ZNF628 PE=1 SV=3
19	Q7YU56	6.58e-05	49.3	1281	0.031	0.023	Q7YU56_DROME RE54443p OS=Drosophila melanogaster OX=7227 GN=CG32767 PE=1 SV=1
20	A0A0C4DG42	6.89e-05	48.9	539	0.063	0.111	A0A0C4DG42_HUMAN Zinc finger protein 34 OS=Homo sapiens OX=9606 GN=ZNF34 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03107 C1_2	7.9e+02	11.8	C1 domain
2	PF05699 Dimer_Tnp_hAT	1.9	19.7	hAT family C-terminal dimerisation region
3	PF02892 zf-BED	7.4	18.0	BED zinc finger
4	PF00096 zf-C2H2	0.00058	31.3	Zinc finger, C2H2 type
5	PF18868 zf-C2H2_3rep	36	16.5	Zinc finger C2H2-type, 3 repeats
6	PF13894 zf-C2H2_4	6.5e-06	37.5	C2H2-type zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000013834

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000017116	0.707	Chromodomain helicase DNA binding protein 2
2	9593.ENSGGOP00000018671	0.653	Zinc finger protein 404
3	9593.ENSGGOP00000006077	0.648	PHD finger protein 14
4	9593.ENSGGOP00000006964	0.648	NPR2 like, GATOR1 complex subunit
5	9593.ENSGGOP00000002619	0.605	Zinc finger protein 385A
6	9593.ENSGGOP00000028538	0.573	Zinc finger protein 688
7	9593.ENSGGOP00000011350	0.539	Ubiquitin-conjugating enzyme E2I
8	9593.ENSGGOP00000012539	0.538	TSC22 domain family, member 1
9	9593.ENSGGOP00000027736	0.537	SLIT and NTRK-like family, member 6
10	9593.ENSGGOP00000002084	0.526	Scm-like with four mbt domains 2
11	9593.ENSGGOP00000023636	0.524	C-type lectin domain family 11, member A
12	9593.ENSGGOP00000003161	0.517	Retinoic acid receptor, gamma
13	9593.ENSGGOP00000020803	0.505	NFKB inhibitor zeta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001221	0.999	transcription coregulator binding
GO:0042802	0.998	identical protein binding
GO:0140110	0.818	transcription regulator activity
GO:0003677	0.808	DNA binding
GO:0000976	0.767	transcription cis-regulatory region binding
GO:0003700	0.760	DNA-binding transcription factor activity
GO:0000977	0.717	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000981	0.645	DNA-binding transcription factor activity, RNA polymerase II-specific

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.997	biological regulation
GO:0051098	0.913	regulation of binding
GO:0050789	0.839	regulation of biological process
GO:0050794	0.783	regulation of cellular process
GO:0051099	0.751	positive regulation of binding
GO:0019222	0.535	regulation of metabolic process
GO:0051171	0.518	regulation of nitrogen compound metabolic process
GO:0031323	0.518	regulation of cellular metabolic process
GO:0080090	0.517	regulation of primary metabolic process
GO:0060255	0.508	regulation of macromolecule metabolic process
GO:0010468	0.481	regulation of gene expression
GO:0048518	0.453	positive regulation of biological process
GO:2001141	0.426	regulation of RNA biosynthetic process
GO:0006355	0.414	regulation of DNA-templated transcription
GO:0048522	0.358	positive regulation of cellular process
GO:0009987	0.306	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043232	0.997	intracellular non-membrane-bounded organelle
GO:0005634	0.956	nucleus
GO:0005694	0.913	chromosome
GO:0000792	0.889	heterochromatin
GO:0098687	0.887	chromosomal region
GO:0000775	0.799	chromosome, centromeric region
GO:0005721	0.788	pericentric heterochromatin
GO:0031981	0.592	nuclear lumen
GO:0005654	0.565	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]