StarFunc result for job id Q5T848

User Input

>input (1215 residues)
MGAMAYPLLLCLLLAQLGLGAVGASRDPQGRPDSPRERTPKGKPHAQQPGRASASDSSAP
WSRSTDGTILAQKLAEEVPMDVASYLYTGDSHQLKRANCSGRYELAGLPGKWPALASAHP
SLHRALDTLTHATNFLNVMLQSNKSREQNLQDDLDWYQALVWSLLEGEPSISRAAITFST
DSLSAPAPQVFLQATREESRILLQDLSSSAPHLANATLETEWFHGLRRKWRPHLHRRGPN
QGPRGLGHSWRRKDGLGGDKSHFKWSPPYLECENGSYKPGWLVTLSSAIYGLQPNLVPEF
RGVMKVDINLQKVDIDQCSSDGWFSGTHKCHLNNSECMPIKGLGFVLGAYECICKAGFYH
PGVLPVNNFRRRGPDQHISGSTKDVSEEAYVCLPCREGCPFCADDSPCFVQEDKYLRLAI
ISFQALCMLLDFVSMLVVYHFRKAKSIRASGLILLETILFGSLLLYFPVVILYFEPSTFR
CILLRWARLLGFATVYGTVTLKLHRVLKVFLSRTAQRIPYMTGGRVMRMLAVILLVVFWF
LIGWTSSVCQNLEKQISLIGQGKTSDHLIFNMCLIDRWDYMTAVAEFLFLLWGVYLCYAV
RTVPSAFHEPRYMAVAVHNELIISAIFHTIRFVLASRLQSDWMLMLYFAHTHLTVTVTIG
LLLIPKFSHSSNNPRDDIATEAYEDELDMGRSGSYLNSSINSAWSEHSLDPEDIRDELKK
LYAQLEIYKRKKMITNNPHLQKKRCSKKGLGRSIMRRITEIPETVSRQCSKEDKEGADHG
TAKGTALIRKNPPESSGNTGKSKEETLKNRVFSLKKSHSTYDHVRDQTEESSSLPTESQE
EETTENSTLESLSGKKLTQKLKEDSEAESTESVPLVCKSASAHNLSSEKKTGHPRTSMLQ
KSLSVIASAKEKTLGLAGKTQTAGVEERTKSQKPLPKDKETNRNHSNSDNTETKDPAPQN
SNPAEEPRKPQKSGIMKQQRVNPTTANSDLNPGTTQMKDNFDIGEVCPWEVYDLTPGPVP
SESKVQKHVSIVASEMEKNPTFSLKEKSHHKPKAAEVCQQSNQKRIDKAEVCLWESQGQS
ILEDEKLLISKTPVLPERAKEENGGQPRAANVCAGQSEELPPKAVASKTENENLNQIGHQ
EKKTSSSEENVRGSYNSSNNFQQPLTSRAEVCPWEFETPAQPNAGRSVALPASSALSANK
IAGPRKEEIWDSFKV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8C419	0.660	0.667	0.000	1200	0.862	0.873	Q8C419.pdb.gz	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
2	AFDB:A0A0R4IF44	0.466	0.325	6.002E-70	1792	0.398	0.270	A0A0R4IF44.pdb.gz
3	AFDB:E9PY61	0.468	0.256	1.770E-64	2293	0.386	0.205	E9PY61.pdb.gz	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1
4	PDB:7e9gR	0.213	0.323	1.805E-9	769	0.046	0.073	7e9gR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
5	PDB:7epaA	0.195	0.287	1.019E-8	782	0.050	0.078	7epaA.pdb.gz
6	PDB:6w2xB	0.207	0.358	3.078E-8	669	0.051	0.093	6w2xB.pdb.gz	Structures of metabotropic GABABreceptor.
7	PDB:7c7sA	0.201	0.342	3.229E-8	685	0.044	0.079	7c7sA.pdb.gz	Cryo-EM structures of inactive and active GABABreceptor.
8	PDB:7e9hR	0.207	0.313	1.241E-7	766	0.051	0.081	7e9hR.pdb.gz	Structures of G i -bound metabotropic glutamate receptors mGlu2 and mGlu4.
9	PDB:7epcA	0.193	0.285	1.366E-7	782	0.054	0.084	7epcA.pdb.gz
10	PDB:7wihA	0.181	0.275	1.585E-6	741	0.048	0.078	7wihA.pdb.gz	Structural basis of the activation of metabotropic glutamate receptor 3.
11	AFDB:A0A2R8QM07	0.173	0.141	7.048E-6	1540	0.093	0.073	A0A2R8QM07.pdb.gz	A0A2R8QM07_DANRE Adhesion G protein-coupled receptor L3 isoform X1 OS=Danio rerio OX=7955 GN=adgrl3.1 PE=4 SV=1
12	PDB:4xesA	0.171	0.377	6.421E-5	471	0.035	0.089	4xesA.pdb.gz	Structural prerequisites for G-protein activation by the neurotensin receptor.
13	PDB:6ffhA	0.165	0.444	1.199E-4	414	0.047	0.138	6ffhA.pdb.gz	Structure-Based Optimization Strategies for G Protein-Coupled Receptor (GPCR) Allosteric Modulators: A Case Study from Analyses of New Metabotropic Glutamate Receptor 5 (mGlu5) X-ray Structures.
14	PDB:6osaR	0.169	0.517	6.148E-4	321	0.033	0.125	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.
15	AFDB:Q54RQ8	0.057	0.038	1.774E-3	2192	0.133	0.073	Q54RQ8.pdb.gz	LVSE_DICDI BEACH domain-containing protein lvsE OS=Dictyostelium discoideum OX=44689 GN=lvsE PE=4 SV=1
16	AFDB:Q17602	0.054	0.049	4.867E-3	1390	0.104	0.091	Q17602.pdb.gz	NU214_CAEEL Nuclear pore complex protein 14 OS=Caenorhabditis elegans OX=6239 GN=npp-14 PE=1 SV=1
17	AFDB:M9NDU7	0.072	0.071	5.622E-3	1222	0.113	0.112	M9NDU7.pdb.gz	M9NDU7_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
18	AFDB:M9PGE2	0.068	0.067	1.213E-2	1257	0.101	0.098	M9PGE2.pdb.gz	M9PGE2_DROME Sodium/hydrogen exchanger OS=Drosophila melanogaster OX=7227 GN=Nhe2 PE=3 SV=1
19	AFDB:Q389X2	0.066	0.065	1.619E-2	1221	0.103	0.102	Q389X2.pdb.gz	Q389X2_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0240 PE=4 SV=1
20	AFDB:P27884	0.075	0.046	3.493E-2	2424	0.093	0.047	P27884.pdb.gz	CAC1A_RABIT Voltage-dependent P/Q-type calcium channel subunit alpha-1A OS=Oryctolagus cuniculus OX=9986 GN=CACNA1A PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PY61	0.0	726	2293	0.353	0.187	GP179_MOUSE G-protein coupled receptor 179 OS=Mus musculus OX=10090 GN=Gpr179 PE=1 SV=1
2	Q6PRD1	0.0	707	2367	0.339	0.174	GP179_HUMAN Probable G-protein coupled receptor 179 OS=Homo sapiens OX=9606 GN=GPR179 PE=1 SV=2
3	Q8C419	0.0	2134	1200	0.862	0.873	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
4	Q8BFV4	3.59e-60	212	333	0.113	0.411	Q8BFV4_MOUSE Uncharacterized protein OS=Mus musculus OX=10090 GN=Gpr179 PE=2 SV=1
5	M9PEK9	1.28e-53	206	926	0.126	0.165	M9PEK9_DROME Smog, isoform F OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
6	M9ND25	9.17e-53	203	951	0.126	0.161	M9ND25_DROME Smog, isoform D OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
7	Q59E18	9.84e-53	203	944	0.126	0.162	Q59E18_DROME Smog, isoform C OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
8	M9NDF0	3.11e-52	201	894	0.126	0.171	M9NDF0_DROME Smog, isoform E OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=1
9	Q9VR40	8.07e-41	165	790	0.103	0.158	Q9VR40_DROME Smog, isoform B OS=Drosophila melanogaster OX=7227 GN=smog PE=1 SV=3
10	Q8IN49	6.21e-12	72.8	807	0.030	0.046	Q8IN49_DROME MIP05539p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG31195 PE=1 SV=2
11	P91685	3.62e-10	67.0	976	0.049	0.060	GRM_DROME Metabotropic glutamate receptor OS=Drosophila melanogaster OX=7227 GN=mGluR PE=1 SV=2
12	H0ZKH5	5.66e-10	66.6	1184	0.064	0.066	H0ZKH5_TAEGU Glutamate metabotropic receptor 1 OS=Taeniopygia guttata OX=59729 GN=GRM1 PE=3 SV=2
13	H0ZRP5	1.10e-09	65.5	1243	0.058	0.057	H0ZRP5_TAEGU Glutamate metabotropic receptor 5 OS=Taeniopygia guttata OX=59729 GN=GRM5 PE=3 SV=2
14	P31424	1.91e-09	64.7	1203	0.055	0.056	GRM5_RAT Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2
15	Q3UVX5	2.11e-09	64.7	1203	0.055	0.056	GRM5_MOUSE Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2
16	P41594	2.97e-09	63.9	1212	0.056	0.056	GRM5_HUMAN Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2
17	A0A0B4KF15	5.30e-09	63.2	1472	0.055	0.046	A0A0B4KF15_DROME Mangetout, isoform G OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
18	Q13255	7.20e-09	62.8	1194	0.062	0.063	GRM1_HUMAN Metabotropic glutamate receptor 1 OS=Homo sapiens OX=9606 GN=GRM1 PE=1 SV=3
19	B7YZT0	1.12e-08	62.4	1415	0.055	0.047	B7YZT0_DROME Mangetout, isoform D OS=Drosophila melanogaster OX=7227 GN=mtt PE=3 SV=1
20	P23385	1.28e-08	62.0	1199	0.061	0.062	GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus norvegicus OX=10116 GN=Grm1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00003 7tm_3	3.5e-35	133.6	7 transmembrane sweet-taste receptor of 3 GCPR

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000365529

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000355523	0.928	Regulator of G-protein signaling 7
2	9606.ENSP00000309493	0.749	G-protein coupled receptor family C group 6 member A
3	9606.ENSP00000479618	0.710	Myc proto-oncogene protein
4	9606.ENSP00000334851	0.708	Regulator of G-protein signaling 7-binding protein
5	9606.ENSP00000380876	0.679	Regulator of G-protein signaling 11
6	9606.ENSP00000359864	0.674	Glypican-4
7	9606.ENSP00000451030	0.620	Regulator of G-protein signaling 6
8	9606.ENSP00000417261	0.598	Probable G-protein coupled receptor 156
9	9606.ENSP00000304169	0.577	Pituitary homeobox 2
10	9606.ENSP00000318480	0.564	ATP-dependent zinc metalloprotease YME1L1
11	9606.ENSP00000261837	0.560	Guanine nucleotide-binding protein subunit beta-5
12	9606.ENSP00000262494	0.544	Guanine nucleotide-binding protein G(o) subunit alpha
13	9606.ENSP00000333496	0.508	Potassium voltage-gated channel subfamily D member 2
14	9606.ENSP00000376403	0.508	G-protein coupled receptor family C group 5 member C
15	9606.ENSP00000246151	0.506	Promotes megakaryocyte differentiation by up-regulating RUNX1 expression . Regulates RUNX1 expression by activating the proximal promoter of the RUNX1 gene and by enhancing the translation activity of an internal ribosome entry site (IRES) element in the RUNX1 gene

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0038023	0.383	signaling receptor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.992	regulation of cellular process
GO:0023052	0.991	signaling
GO:0007154	0.990	cell communication
GO:0050896	0.983	response to stimulus
GO:0051716	0.974	cellular response to stimulus
GO:0007186	0.931	G protein-coupled receptor signaling pathway
GO:0051179	0.868	localization
GO:0051641	0.769	cellular localization
GO:0051668	0.739	localization within membrane
GO:0072659	0.609	protein localization to plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005886	0.976	plasma membrane
GO:0005622	0.350	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]